Conserved Protein Domain Family
CCDC158

?
pfam15921: CCDC158 
Coiled-coil domain-containing protein 158
CCDC158 is a family of proteins found in eukaryotes. The function is not known.
Statistics
?
PSSM-Id: 318193
View PSSM: pfam15921
Aligned: 3 rows
Threshold Bit Score: 1944.14
Threshold Setting Gi: 795292422
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422    1 MESKACESNNEDILSSSGVTSNEGSSSPFFVSSIRGTIIENTSSAGTLTQVPFFPKYEVELDSPRKIIQYPGKEHFERVL 80
gi 351706599    1 MEPKPCESNAEDLLSSSGITSNRGPSSSFFVSSVRGTVIENTASTGTFTQIPIFPKYEVELDSPRKIIAYPGKEHIERVL 80
gi 946733343    1 MEKKPCESHNED-LSSSGIASNGGSSSPFFMSPIRGTIIENASAPGIVTQIPLFPKYEVEPDSHRKVIPYPGKEHIERVL 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422   81 EEYSHQVKDLQRRLNESNELHEKQKFYLRQSVIDLQTKLQEMQMERDAMADIRRRESQSQEDLRNQLQNTVHELEAAKCL 160
gi 351706599   81 EEYSHQVKDLQRRLNESNELHEKQKFYLRQSVINLQTKLQEMQMERDAMADIRRRESQSQEDLRNQLQNTVHELEAAKCL 160
gi 946733343   80 EEYSHQVKDLQKRLNESNELHEKQKFYLRQSVIDLQTKLQEMQMERDAMVDIRRRENQSQEDLKNQLQNTVHELEAARSL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  161 KEDMLKDSNTQIEQLRKMMLSHEGVLQEIRSILVDFEEASGKKIYEHDSMSTLHFRSLGSAISKILRELDTEISFLKGRI 240
gi 351706599  161 KEDMMENSSTQIEQLRKVMLSHEGVLQEIWTILVDFEEASGKKIHEQDNMSTMPFRSLGTAVSKMLRELDTEISYLKGRI 240
gi 946733343  160 KEDMLNDSNTQIDQLRKMMLSHEGVLHEIRSILVDFEQASGKKIYEHDSLSTIHFRNMGSAISKILRELDTEISYLKGRI 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  241 FPV-EDQLEALKSESQNKMELLLQQHQDRIEQLISEHEVEITGLTEKASSARSQANSIQSQMEIIQEQARNQNSMYMRQL 319
gi 351706599  241 FPVsEDQLETLKAESQNKIELLLQQHQDRIEQLISEHEVEITGLTEKASSARSQANSIQSQLEIIQEQARNQNSMYMCHL 320
gi 946733343  240 FPV-EDQLEALKSESQNKIELLLQQHQDRIEQLISEHEIEITGLTEKASSARSQANSIQSQLEIIQEQARNQNAMYMRQL 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  320 SDLESTVSQLRSELREAKRMYEDKIEELEKQLVLANSELTEARTERDQFSQESGNLDDQLQKLLADLHKREKELSLEKEQ 399
gi 351706599  321 SELESTVSQLRSELREAKRMYEDKIEELEKQLVLANSELTEARTERDQFSQESGNLDDQLQKLLADLHKREKELSLEKEQ 400
gi 946733343  319 SDLESTVSQLRSELREAKRTYEDKIEELEKQLVLANSELTEARTERDQFSQESGNLDDQLQKLLADLHKREKELSLEKEQ 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  400 NKRLWDRDTGNSITIDHLRRELDDRNMEVQRLEALLKALKSECQGQMERQMAAIQGKNESLEKVSSLTAQLESTKEMLRK 479
gi 351706599  401 NKRLWDRDMGNSITIDHLRRELDDRNMEVQRLEALLKTMKSECQGQMEQQMAAIQGKNESLEKVSSLTAQLESTKEMLRK 480
gi 946733343  399 NKRLWDRDTGNSITIDHLRRELDDRNMEVQRLEALLKAMKSECQGQMERQMAAIQGKNESLEKVSSLTAQLESTKEMLRK 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  480 VVEELTAKKMTLESSERTISDLTTSLQEKERAIEATNAEITKLRSRVDLKLQELQHLKNEGDHLRNVQTECEALKLQMTE 559
gi 351706599  481 VVEELTAKKMTLENSERTVSDLTASLQEKERAIEATNSEITKLRSRVDLKLQELQHLKTEEEHLQHAQTECEALRLQMAG 560
gi 946733343  479 VVEELTAKKMTLESSERTVSDLTASLQEKERAIEATNAEITKLRSRVDLKLQELQHLKNEGDHLRNVQAECDALKLQMAE 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  560 KDKVIEILRQQIENMTQLVGQHGRTAGAMQVEKAQLEKEINDRRMELKELKILKDKKDAKIRELEARVSDLELEKVKLVN 639
gi 351706599  561 KDKVIEILRQQIENMMQLVGQHGRTAGAILVEKAQLEKEINDRRLELQEFKVLKDKKDAKIRELEAKVSDLELEKVKLVN 640
gi 946733343  559 KDKVIEILRQQIENMTQLVGQHGRTAGAMQVEKAQLEKEINDRRLELQEFKILKDKKDSKIRELEARVSDLELEKVKLVN 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  640 AGSERLRAVKDIKQERDQLLNEVKTSRNELNSLSEEYEVLKRNFRNKSEEMEMTTNKLKMQLKSAQSELEQTRNTLKSME 719
gi 351706599  641 AGSERLRAVRDIKQERDQLLNEVKNSRSELNNLSEDYEVLKRNFRNKSEEMETTTNKLKMQLKSAQSELEQTRNTLKSME 720
gi 946733343  639 AGSERLRAVKDIKQERDQLLNEVKTCRNDLNSLTEDYEVLKRNFRNKSEEMETTTNKLKMQLKSAQSELEQTRNTLKSME 718
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  720 GSDGHAMKVAMGMQKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKEEKSKLSQELSTVATEKNKMAGELEVLRSQE 799
gi 351706599  721 GADGHAVKVAVGMQKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKEEKNKLSQELSTVATEKNKMAGELEVLRSQE 800
gi 946733343  719 GSDGHAMKVAMGMQKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKEEKNKLSQELSTVATEKNKMAGELEVLRSQE 798
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  800 RRLKEKVTNMEVALDK--------------ASLQFAECQDIIQRQEQESVRLKLQHTLDIKELQGPGYTSNSSLKPRLLQ 865
gi 351706599  801 RRLKEKVANMEVALDK--------------ASLQFAECQDIIQRQEQESVRLKLQHTLDVKELQGPGFTSNSSMKPRLLQ 866
gi 946733343  799 RRLKEKVANMEVALDKcihflecpphtkcyASLQFAECQDIIQRQEQESVRLKLQHTLDVKELQGPGYTSNPSVKPRLLK 878
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  866 PASVTRSHSNVPSSQSTASFLSHHSTKANTLKEDPTRDLKQLLQELR--------SVINEEPAVSLSKTEEDGR-TSL-- 934
gi 351706599  867 PASFTRTHSNVPSSQSTASFLSHHSRKTTALKEDPTKDLKQLLQELR--------SVINEEPTVQLSKAEDKGRaPSL-- 936
gi 946733343  879 PSA--RPHSNMPSTQSTASFLSHHsMKPNALKEDPTRDLKQLLQELRsvineepsAPVGKAEDD--GRAPSLGVtFGAvd 954
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422  935 GALEDRVRDCITESSLRSDMCHRSNNSL--RdsTEGSKSSETLSREPVTLHAgDMEDPSGCFTFASAASPSVKNSASRSF 1012
gi 351706599  937 GALDDRVRDCIIESSLRSDICHSSSCFV--Q--TRKLTLSFLCFREPVLLHA-ELEDPSSCFTFPSTASPSVKNSASRSF 1011
gi 946733343  955 GRVRDCITESSLRLEMCHRS----SNSLrdS--TEGSKSSETFSREPVALHAgELEDPSSCFTFPSTVNPSVKNSATRSF 1028
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 795292422 1013 nSSPKKSPVHSLLTSSVEGSIGSASQYRSAKPIHSSDSVKDSQSPPIETTGKTCRKLQNRLESLQTLVEDLQMKNQAMSS 1092
gi 351706599 1012 -TSPKKSPVHSLLTSLAEDSVGSSPQYGSTKTIPSPDSAKDSQSLPVETTGKTCRKLQNRLESLQTLVEDLQLKNQAMSL 1090
gi 946733343 1029 hSSPKKSPVHSLLTSSAEGSICSTSPYRSAKTIHSADSVKASQSQPIETTGKTCRKLQNRLESLQTLVEDLQLKNQAMSS 1108
                        1130      1140
                  ....*....|....*....|.
gi 795292422 1093 MIRNQEKRIQKVKDQEKMLLK 1113
gi 351706599 1091 MIRNQEKRIQKVKDQEKMLLK 1111
gi 946733343 1109 MIRNQEKRIQKVKDQEKMLLK 1129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap