Conserved Protein Domain Family
YdiH

?
pfam15930: YdiH 
Domain of unknown function
YdiH is a family of proteins found in bacteria. Proteins in this family are typically between 62 and 80 amino acids in length. The function is not known.
Statistics
?
PSSM-Id: 318201
View PSSM: pfam15930
Aligned: 2 rows
Threshold Bit Score: 98.956
Threshold Setting Gi: 150954929
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 269849507  1 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLGVH 62
gi 488992645  1 MDTELTPTQMAIEFLRRDPTVMTPAQYLKKLKLLELEFADLMALSSLELKEEIDLAWRLGIH 62
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap