Conserved Protein Domain Family
DUF4754

?
pfam15946: DUF4754 
Domain of unknown function (DUF4754)
This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.
Statistics
?
PSSM-Id: 318213
View PSSM: pfam15946
Aligned: 2 rows
Threshold Bit Score: 154.45
Threshold Setting Gi: 446436422
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 446436422  1 MGKEYKTLINKALERFYFRLSASGAHAERAARDSLTRAIRSLYDVAFYADDLDALNELSELICAAECGEHIEPYKLGNIA 80
gi 309702164  2 MGKEYKTLINKALERFYFRLSASGAHAERAARDSLTRAIRSLYDVAFYADDLDALNELSELICAAECGEHIEPYKLGNIA 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap