Conserved Protein Domain Family
DUF4755

?
pfam15947: DUF4755 
Domain of unknown function (DUF4755)
This family of proteins is found in bacteria. Proteins in this family are approximately 160 amino acids in length.
Statistics
?
PSSM-Id: 318214
View PSSM: pfam15947
Aligned: 2 rows
Threshold Bit Score: 225.338
Threshold Setting Gi: 502390570
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 498302735  61 NYLNENNDGIYLHKFNDCEIRLDTNKQEVFLKNSEGANTYSFEEIKEWSYNITYGGEV-AGTGLSSIRENGKTLSQNIAD 139
gi 502390570  53 EWLGLAEGCQYQHYHKSTGIGMNTATRQVYLFDGDKFKRYDFTDIRNWSYSVLTGGTTmSNRTLAEGAHNSRQNKENEAG 132
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*....
gi 498302735 140 TGLFIRVKDVRKPEWHIRFyPRNDSFNsrkgiNDLKAQLNQWMEIFDQN 188
gi 502390570 133 SGLFLDVKDIDHPEWRVAF-PWHATNN-----RKTEVELKRWMEIFQQN 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap