Conserved Protein Domain Family
DUF4761

?
pfam15958: DUF4761 
Domain of unknown function (DUF4761)
This family of proteins is found in bacteria. Proteins in this family are approximately 110 amino acids in length.
Statistics
?
PSSM-Id: 318223
View PSSM: pfam15958
Aligned: 4 rows
Threshold Bit Score: 192.142
Threshold Setting Gi: 332090865
Created: 13-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 332090865  13 FRNGAERYANRFATSASRSSSRYSLSDTHATPDGHAVKQTGNHSWLVEKAGIAIHKCPRNPLTGNHIFTLSCGDNQFGQD 92
gi 446840552   8 FRTGTERHANHFATNASRSNIRYSLSETHATPDGHTVKQIGEHTWLIEKAGIVVHRCPRNPFTGNRIFALSSGDNQFGQD 87
gi 502670372  12 FRNGAERHANRFATSASRSSSRYSLSETHATPDGYPVKQIGEHTWLIEKAGIVVHKCPHNPFTGNRIFALSSGDNQFGQD 91
gi 446736039  12 FRNGAERYANRFATSASRSNIRYSLSETHATPDGHAVKQIGEHTWMIEKAGIVVHKYPRNPFTGNRIFALSCGDNQFGQD 91
                         90       100
                 ....*....|....*....|....*
gi 332090865  93 FTLTEALRTVDRLLCGGNFIKQTEL 117
gi 446840552  88 FTLYEALRTVDRLLRGQSFIKQTDL 112
gi 502670372  92 FTLYEALRTVDRLLRGQSFIKQADL 116
gi 446736039  92 FTLYEALRTVDRLLYGENFIKQAEL 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap