Conserved Protein Domain Family
DUF4764

?
pfam15961: DUF4764 
Domain of unknown function (DUF4764)
Statistics
?
PSSM-Id: 318226
View PSSM: pfam15961
Aligned: 16 rows
Threshold Bit Score: 1009.32
Threshold Setting Gi: 557020309
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641     7 IQPQTARKSQLPRGN-SCLVGLHIASPQLLRVQPLVRTE--PQSCFLSDLCQPPA-QGFVQRPLPALQVVP-AKRVPAPK 81
gi 532112771    31 IQPQTARQSQPPGRS-SSLVGLRVACPQLLRGQPSGRTG--PQLCFLRSSLRPPVpRVFVQRPLPALQPVP-PKRVKASQ 106
gi 1040121088   84 IRPQAARQDQLPGRN-PCLVGPRATSPQLLRGQPLLKAR--PQP--------PAP-QLLVQRPVPAKR------------ 139
gi 557020309   343 VQPKIVALNQSANKCvSAASALNFIGPQIIRIQPVAGTG--QQQLFLHSSSEPPI-QLLVQKAPPPLGPITtVRKIPLYK 419
gi 733890565    14 IQSKTVMLSQSVGRN-SSMPGLGIINPQIIKIQPVTGPEq-QQQLFLHSSSESPV-QLLMQKPLPSHGSVP-VNKIPTSK 89
gi 514751060    14 VQPKTITLSQSVGRN-SSIPGLGVINPQIIRIQPVTGTEqeQQQIFLHSSSESPI-QLLVQRPLLSGGSVS-VNKTATSK 90
gi 545508568   123 IQPKPASLSQLPVRH-SRVLG--------LRVQPVLNTG--PQPRFPGNL--PPV-QVFIQRPLPTLQPV---------- 178
gi 755745033    14 lQPRTAGLSQPPRGA-PGVLG--------LRAQP----------RFPSNS--PPI-RVFVQRPLPALQLV---------- 61
gi 241897001   108 IQLKTARQSQLPGRS-PS-KGVCVSSPQLLRVQALGRTE--SQLQFLRRSPQPPApRVFVQKMLPDLHPVP-LKRAKAHE 182
gi 564307799     7 IQPKTVRQSQLPGGS-SS-MGVSASSPQLLRVQALGRTE--SQPRTCRGSLQPPApQALVQRV---------SKRVKAHR 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641    82 APDEQGSMLTPLSASDPLAVTSLSSSSAHPFISNLHTRHT-EKL--KKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLAD 158
gi 532112771   107 APGGQGDRLTALAASHLPTRTSISSSSHLLI-SSLHTKHA-KKL--KKSFKVQTRSGRISRPPKYKARDYKFIKTEDLAE 182
gi 1040121088  140 -------------APGPPAVTSASASSAHSFISNSPTEHT-EKL--KKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLAD 203
gi 557020309   420 PINGQMSASGILTTS-SSNVIPVTTSVTELSI---DKKLK-DKLrvKRPLKVKTRSGRISRPPKYKVKDYKFIKTEDLAD 494
gi 733890565    90 VLNGQKTARATVSPARSSNI---AASSTNTLMPCLEKKQKdDKL--KKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLAD 164
gi 514751060    91 MLNGQKTARATVSATRSSNITMVAANSTNTLTPCLEKKQK-DKL--KKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLAH 167
gi 545508568   179 APNGQGAALAPFSASDPPAATSVSSSSANSFIS--HTKHT-EKL--KKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLAD 253
gi 755745033    62 APQGLGATPAPLSASDPPAVTSVSSGSANFFISSLHTKHT-EKL--KKSLKVKTRSGRISRPPKYKVKDYKFIKTEDLAD 138
gi 241897001   183 TASGCGIALSPVAASGTRAVAAVPSS---LLISSLHTART-EKS--KKSLRVRTRSGRVSRPPRYKARDYKFIKTEDLAE 256
gi 564307799    74 TAHGRGITLSPVAASGPHTLAAVSSGSARLLISSLHTAHT-EKS--KKSLRVRTRSGRVSRPPRYKARDYKFIKTEDLAE 150
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   159 GHLSDSDDYSELCVEEDEDQ--RERHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHG--QLDPEMVLSE- 233
gi 532112771   183 GHPSDSDDYSELSTEEEEGQ--REKQALFDLESCALRPKTFRCQTCGKSYIGKGGLARHFKLNPGHG--QVDPETPLPE- 257
gi 1040121088  204 GHVSDSDDYSELSVEEDDDR--REKQALFDLASCSLRPKTFQCQSCEKSYIGKGGLARHFKLNPGHC--LG----RLPE- 274
gi 557020309   495 GHQSDSDDYSELSVEEDEEG--VKKDIAFCPLNYNLKPKKFKCETCEKSYIGKGGLARHYKLNPSH----EQPNFLQTNq 568
gi 733890565   165 SHQSDSDDYSELIIEDDEEGkvKGKDALFNSSNYNLKPKMFKCQTCEKSYIGKGGLARHYKLNPGHGqlESVPQKTPLN- 243
gi 514751060   168 GHQSDSDDYSELSIEDDEEGkvKGKDALFNSSNYNLKPRMFKCQTCEKSYIGKGGLARHYKLNPGHGqlEPAPQKIPLN- 246
gi 545508568   254 GHLSDSDDYSELSVEEDEEQ--RGKQALFDLSSCSLRPKTFKCPTCEKSYIGKGGLARHLKLNPGHG--QLESEVSPSE- 328
gi 755745033   139 GRLSDSDDYSELSVEDDDDQ--RGKRALFDLSSCSLRPKTFKCQTCEKSYIGKGGLARHLKLNPGHG--HPEPEVSLSE- 213
gi 241897001   257 GRLSDSDDYSELSVEEEEEP--PEKPAFFDVEVCALRPKAFKCHTCGKSYIGKGGLSRHCKLNPGHS--RLQPGVLLLE- 331
gi 564307799   151 GHLSDSDDYSELSVEEEEEL--REKPAFLDLEVCALRPKAFKCQVCEKSYIGKGGLARHCKLNPDHC--QLQPEALLCG- 225
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   234 ----KASGSTL------RGCTE--ER---TLSLTSLGLSMP---A-----DPCEGGars----------clvTES----- 275
gi 532112771   258 ----KATGSLS------LGCTE--ER---TGGLTSPERCAP---A-----AKREEG----------------AES----- 293
gi 1040121088  275 ----TAHGSLI------QGCVA--AG---PVSLTSPELATP---TeegplSCCARG----------------AES----- 315
gi 557020309   569 rssvKPNGGVP------VTDSG--GG---GDDSSSVLVSEP---L-----VMLSLN----------------NECvspvi 613
gi 733890565   244 ----KPNGSISmdnlcgIGEEI--MS---PVHLNSIAVTLNnenA-----LPTNLEetag--------sqveQTC----- 296
gi 514751060   247 ----KPNGSIF---------VDnpCGtgvETMSPAHLDSIA---V-----TfnneyalptnleetvglqpggQNC----- 300
gi 545508568   329 ----KANG----------------SR---SASRTSPQLPTP---A-----LLSEEA----------------APS----- 356
gi 755745033   214 ----KANGSTT------RGCAE--GR---TASLPSPGLPTS---A-----LLGEEG----------------AQS----- 249
gi 241897001   332 ----KADGGPT------LGCTD--SK---TGGLAGPEPSTA---A-----ALCVEE----------------AES----- 367
gi 564307799   226 ----KANGSPT------LGCSD--SK---TRGLACLKPSIP---A-----THCMEE----------------AGS----- 261
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   276 -------ARGGLQNGQSVDVEETLPSE-PENG---ALLRSERYQGPRRRACSETLAESR-----TAVLQQRRAAQLPGGP 339
gi 532112771   294 -------EQGGQQDGQS--VEEALVPE-PENGshsALLGSESHLGPRRSGDLQTLAESS-----AAVHQRIRASQPHEGP 358
gi 1040121088  316 -------AHHGLQNGQSTEAEEVLVTE-PESKspaALLGSQTHLGCAGSGDPETPAEPSaaeagAAVLPQSR-------- 379
gi 557020309   614 eevttapSQESQQDLQLVVPEQTVVLQlPAPQgpgRPRGPGRTRGPKRSRQSALAGRPG-----YAV-RSGRPGRPP-KS 686
gi 733890565   297 ------------KSAES----RKLLAE-QQNEsssGQRGPITAKGPGRPRRPKRRGRPRmggrsRCSGRLSRPGQSPSKP 359
gi 514751060   301 ------------NSGES----RHLMEE-QQNEsssGHRGPIKPKGPGRPRRRKRHGRPRmggrsRCSGRLSRPGQSPSKS 363
gi 545508568   357 -------AGAGLQNSQSIEVEEALVSE-PENGsysALLGPEGHPGPRRSDCSTAPAEAN-----TAVLGRSSEAHLPEDA 423
gi 755745033   250 -------PPCGLQNSQSVEVEDALVSE-PEDGnysAFVGSERHPGPRRIEFAAAPAEAS-----EAVLGRGGAAHPRGRS 316
gi 241897001   368 -------AWHTLQSGQPVEVEETLVPE-PQNRstsALLRPEKYLGP-KNRNWESQAEVS-----TASLRESRAVQPEGDP 433
gi 564307799   262 -------AWPTLQNGEPVEVEETLVPE-PQNRspsALLRPEKYLKP-KSGNWESQAEFS-----TASLQESRAVQPNSHP 327
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   340 AA--AGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQ 417
gi 532112771   359 AG--TMRRNASGSRALLEECLQHCDQKDLVELALPQLAQVVTMYEFLLMKVEKGHLAKPFFPAVYKEFEELHNMVKKLCQ 436
gi 1040121088  380 ----AGGQRASRGRAELQQLLQQCDPEDLVELALPQLARAVTLYEFLLMKVEKGHLAKPFFPAVYKEFEELHKMVKTLCQ 455
gi 557020309   687 LGniTTEQQVTRRKARLKEILQQCENEELMELALPRLTKVITVWEFLLMKVEKGYPSKPYFADVYKEFEDLYTMVKKMAE 766
gi 733890565   360 LSsvSTERNVFRRRARLKELIQQCDNEDLMELVLPRLTELVTVYEFLLMKVEKGCPAKAYFPDVYREFEELHNMVKKMAY 439
gi 514751060   364 LSsvSTEHNVFRRKARLKELIQQCDNEDLMELALPRLTKLVTVYEFLLMKVEKGYPAKAYFPDVYREFEELHNMVKKMAY 443
gi 545508568   424 RA--AGVQSTSRARARLKEFLRGCDRDALVELALPPLAQVVTVYEFLLMKVETSHLAKPLFPAVYKEFEELHKMVKKMCQ 501
gi 755745033   317 GAcvAGAQSASAARARLEEFLQQCDREALVDLVLPQLAQVVTVYEFLLMKVETGHLAKPLFPAVYKEFEELHKRVKKMCQ 396
gi 241897001   434 AV--PSGLSVSGG-AQLREALKQCGREELVELVLPQLAQVVTLYELLLVKVEKSPRAKPFFPAVYKEFEELYDMMKRMCQ 510
gi 564307799   328 AG--PSGLSVSRG-AELREALRQCGREELLGLVLPQLAQAVTLYELLLVKVEKSPRTKPFFPAVYKEFEQLYDVVKRMCQ 404
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   418 DYLSSSGLCS-QETLEINNDKVAESLGIT-EFLRKKEIHPDNLGPKHLSRDMDGE---QLEGASSEKREREAA-EEG--- 488
gi 532112771   437 DYLSGSGPCS-QEPLEVNNDKVAESLGITeEFLRKKETHPGCNPPKRPSQEMEGE---KLEAASHQQRGNEAT-EEE--- 508
gi 1040121088  456 DYLSGSSPGP-QEPLEVNNDAVAESLGITeEFMRKRDMCTDCLAAQCPGPEGRE----RLEEASGQKRGSEAT-QDL--- 526
gi 557020309   767 DHFNNSVHLSlQRSLEIKNVKVAESLGILeKVLRKQKQQAADTSERDVVVTIDDQ---LKLHSSAKKHGIEREdEKL--- 840
gi 733890565   440 DYLSNSDFLScQQPIEIKDAKVAESLGITeITSGEQKMQGVDSCSQCIIKMVSEQ---VPVETLGQKRLAESSgEEL--- 513
gi 514751060   444 DHLSNSDLLScQQPVEIKDAKVAESLGITeILTGEQKVQGIDSCSQHIIKMGSEQ---VPVEILGQKRLAESSgEEL--- 517
gi 545508568   502 DYLSGSGLCS-QEPLEISNNKVAESLGIL-ELLRTRAACRS-----------GGPgraEPEDASQQKRANETA-EEG--- 564
gi 755745033   397 DYLSGSGLCS-QEPLEISNDKVAESLGIT-EFLRRREARTECVPAQHTSGDTGRDsqaELEEAGQQKRGNETA-DGA--- 470
gi 241897001   511 DYLSSAGAYP-QEPLEISNDEVARSLGIT-EFLRRKET------PTCSSQETEG----RLEKGCVRKRARELG---K--- 572
gi 564307799   405 DYLSSSGACS-QEPLEINNDEVARSLGIT-EFLRKKET------PKCSSQETEG----KLEEGSGRKRERELG---Alat 469
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   489 ---LASVKRPRREALSNDTTE--SLAANSRGREKPRPLHALA--A--G----FSPPVN------VTVSPRSEESHTTTVS 549
gi 532112771   509 ---LAMVKRPRRDAVCTDALK--SPAAHSGGQEKTGPSNAPA--AceG----FASPAS------GSAPPYSEESHGMALF 571
gi 1040121088  527 ---QASVKRTRTETLPEDTAE--SPAAEGTGQAKPRPLCDPA--A--G----LACPAN------ENASPRSESSQAVTGC 587
gi 557020309   841 ---LPPDKRARIEISLIDTNS--TYFSQKGKLVEALHLSGLT--A--EegiiKQVNGD------SKIACITNGSLGVRTE 905
gi 733890565   514 ---LPSAKRTKLEDVMENVNN--AYSSQDEVKEKSGNLCTLF--E-----------KDglnplnGEILL---SEDRHVTC 572
gi 514751060   518 ---LPSAKRTKLEDVMENVNN--AYASQDEVKEKSGNLCTLFekD--G----FNPLNG------ENCFLLSES--KHITC 578
gi 545508568   565 ---LAWAKRTRREAAPRDTLE---PSVDGGGLQKP-ASCAPA--A--Se--gCASQGR------GSASQHSEESHAMLVS 625
gi 755745033   471 ---PAWVKKTRRDPLPQDTTDggAPAANQG----------------------PAPPAS------GNAPRRPEGSRTAPVS 519
gi 241897001   573 ---LATVKKPRTVALPTDVPG--YPPSANGCQQEPGPSPALA--T--Sk---gSDPAA------GENSLCSEGSCWEMVP 634
gi 564307799   470 gegLATVKKPRTVALPTDVPE--YLPSTSGCQQKSKSSRAPA--I--Sk---GSEPAA------TECSLCSEGSCREMVP 534
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   550 GGNGSVFQAGPQLQALA--NLEA-RRGSIGAALSSRDVSGLPVYAQ--------SGEPRRLTQAQ-----------VAAF 607
gi 532112771   572 NSGRSKLHVGQQLKAFD--DFRA-RRRSVGSAPLCGATSRPALHAQ--------LREPGGLPPAQ-----------VAAL 629
gi 1040121088  588 DGGRSLVHEGRQLKAFA--DSEA-RSGCVGPAPCCSDRGGAPPCIQ--------LGEPARLARLQ-----------QAPL 645
gi 557020309   906 DTSSVSLHSTNEFKGPI--GVEAdTNPCHSNLLLYQSTE---------------VASQPSLEGIQgqsgtgdeqehTVAF 968
gi 733890565   573 CTTGSILPAEEEHNLLV--DSEV-RINAENSGTFSQTVETRIEYSQpvdgqgpgmsad-------------------tsl 630
gi 514751060   579 CTTGSLLPAEEQNS-LV--GSEV-RISAENSGPFSQAVKMRIEYSQptdtqgpdTAGDMSLLHTE-----------VILP 643
gi 545508568   626 DSDGSMLHTGRQLKAFA--DLEA-KSGSVAPALSCQSISGPSLYSQ--------LGEPGTRTRGQ-----------VAAF 683
gi 755745033   520 G------RAGRQLQAFA--DAEA-KSGCGAPALSCENVSGLSLCPQ--------SGEPGTHTQGC-----------VPAL 571
gi 241897001   635 ASDRNAPPAGSWLLVMAsdDFEA-RNGSADPTLLFQDVSGSALYSQ--------VAEPSRMHPAQ-----------ESVF 694
gi 564307799   535 DSDGNGPPVGQRHPVMApdDFEA-RNSSADPTLVCQDVSGSVLHSL--------VAEPRGMPAAR-----------ESVF 594
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   608 --------PGEN-----ALEHSSDQD-TWDSLRSPGFCSPLSSGGGAESL-----------PPGGP-------------- 648
gi 532112771   630 --------PEDN-----DPEHSADSN-TRDSQRSPGVCG-VLSGRRGECL-----------LPGRS-------------- 669
gi 1040121088  646 --------PDRK-----ALGHSSDQD-TGDSPRGPAACSTLSAGGGVQPL-----------LLGAS-------------- 686
gi 557020309   969 lsmdtditSEDL-----VQEHLSNHS-MADQLTDVELSDPVQTEHGIHSSstllssinkgnLHKSE-------------- 1028
gi 733890565   631 lhteivlpvEAGgspelAEAHMVSQN-TAGGLSAAEPCNSV-SEHAVGIQ-----------STNLA-------------- 683
gi 514751060   644 --------VEADgsaelIQAHFVSEN-TAGGLSAPPLCNSV-SEHAVGIQ-----------TTDLSrkeenglnqkyqsl 702
gi 545508568   684 --------PEDN-----AQEQSVAWH-AGDSLGSRRLCSPLLPPGAVESL-----------LPSGS-------------- 724
gi 755745033   572 --------PGEN-----AQERSADWNgTGNSLGSGDLCRTLMFPGGVASL-----------PPSGP-------------- 613
gi 241897001   695 --------SEEN-----IPEHTMYQD-SGAVWKSNSVCDMPSSGRRIGSL-----------LFRES-------------- 735
gi 564307799   595 --------SEET-----APEHTIDED-SVALRKSNSVCDTPSLGGRVE--------------LRES-------------- 632
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   649 -------------------GHAEAGHLGKVCDFHLNHQ------QPSPTSVLPTEVAAPPLEKILSVDS-VAVDCAYRTV 702
gi 532112771   670 -------------------GSAEVGNRGEMCGSHLNCQ------QVGPRHSV-----APSL-KILPMDA-MPVDCASRTV 717
gi 1040121088  687 -------------------GS------RGRRDAHLPGQ------QARPSPDLLTAAAAPPLEKAVPAGV-GPVDCACSTV 734
gi 557020309  1029 -------------------STQEHCNSMNSRDPLTNHE------RSEQLHASVIADQMQQLENVLSTAI-VSLDHSNRTQ 1082
gi 733890565   684 -------------------VSEENGLNEKCQAPQEENQnfalkgQSEQLHDAGMAE-MQEMEKAFSTH--VPINYPHGAQ 741
gi 514751060   703 qeeshvfavkgrseqlhnaDTTEE---------------------------------TQQLGKVFSTN--VPISHPHHAQ 747
gi 545508568   725 -------------------GSLE------VHDSHQKGQ------RSSSSDVLLTEVVGPRLEKVLSVNV-VPADCAPRTV 772
gi 755745033   614 -------------------GDLE------RHGSLWKGP------RSGPSDVLFPEAAGPLLERVLSVDV-GPADCVPRTV 661
gi 241897001   736 -------------------ENAEAGALRETNQPFLDGQ------QASPSHVLLAEAAAVPLHNTVPVNIlLPAACVSKIM 790
gi 564307799   633 -------------------GTAEAGDLRETDQTHLSGQ------QAIPSHALLAEAAAVPLHSILPANT-LPAACVSKIV 686
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 182627641   703 --P-----------KPGPQPGPHGSLLTEGC--LRSLSGDLNRFPCGMEVHSGQ--RELESVVAVGEAMAFEISNGSHEL 765
gi 532112771   718 --S-----------EPGPQPGPDGSLPTKEG--LGSQAGDLNWFPCGTQVHIDQ--RELESVVAVGEALAFEIPSGCQML 780
gi 1040121088  735 --S-----------QPGPQPGKDGSLSTRGG--VESHTGNLNQFPCGTEVHGSQ--RELEGMVAVGEAVAFEIPSGCH-- 795
gi 557020309  1083 --SgelrdqiihetASSTQVRLESQISHESV--KSLQVANPNEL-CSEIEQSSSihSDVESTVTVDETVAFQLSDESHEL 1157
gi 733890565   742 --A-----------ELHQNSVQETTLSAGVN--HDCAYSNMSEFSCGTEGQ-----HELENAVTIDQTVAFEITDESHDF 801
gi 514751060   748 --T-----------ELHQNPVQEVSLPAHLS--QDCSFKNTGEFSCGTGEQ-----HELENTITVDETVAFEITDESHGF 807
gi 545508568   773 --R-----------ELGPQPGQAALLSTGGD--QGSRVGDLDHFPCGAEVHADQ--QELESVVAVGEAMAFEITDGCHEL 835
gi 755745033   662 --P-----------EPGPQPAQARSLPTDGG--QGSHAGGVDHFPAGPEAHADQ--RELESIVAAGEAVAFEITNGCHEF 724
gi 241897001   791 --P-----------EPVLHPGPGGSLSTDGGpsVGREAGDISQPLSRMETH-DQ--REPETVTAVGEALAFDISNVYQEV 854
gi 564307799   687 peP-----------EPVLHPGPGGSLCTSGDprVGSDAGDISQLLSRMETH-GQ--RETETAAAIGEPLAFDISDVCQEV 752
                          970       980       990      1000
                   ....*....|....*....|....*....|....*....|.
gi 182627641   766 LSQGQKQIFIQTSDGLILSPPG-T-IVSQEEDIVTVTDAEG 804
gi 532112771   781 ---SQEQIFIQTSDGLILSHPG-T-IVSQGEDIVIVTDAKG 816
gi 1040121088  796 -----EQILIQTPDGLILSHPG-T-IVSQ-QDVVIVTEAAG 828
gi 557020309  1158 LTQGHEQIFIHTSDGLILSHPGaA-LVSQTEGIVIVTNADG 1197
gi 733890565   802 LTQGHEQIFIQTSDGLILSHPN-AaVLSQAEGIVIVTDSDG 841
gi 514751060   808 LTQGHEQIFIQTSDGLILSHPD-TaLLSQAEGIVIVTDSNG 847
gi 545508568   836 LSQGQEQMFLQTSDGLILSHPG-S-IVSGEEDMVLVAGAEG 874
gi 755745033   725 LSQGQEQIFIQTSDGLILSHPG-S-VVSGEEDVVIVAGMEG 763
gi 241897001   855 LSQGQEQIFIRTSNGFILSYPS-T-IVSQEDDSVVVTNARG 893
gi 564307799   753 LSQGQEQIFIRTSNGFILSYPS-T-IVSQEEDSVIVTNATG 791
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap