Conserved Protein Domain Family
zf-TRAF_2

?
pfam15965: zf-TRAF_2 
TRAF-like zinc-finger
Statistics
?
PSSM-Id: 318230
View PSSM: pfam15965
Aligned: 30 rows
Threshold Bit Score: 124.741
Threshold Setting Gi: 393911700
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1005955903   33 HSHCDNCIKItKCRYKNARDAACPIISCK-EGCGFRFHRCKSDEHQLLCANEKILCINHNFGCPAFLPRKDLSKHI-SRC 110
gi 260798682     1 HSHCTQCYRR-SCFVKPELDVSCEMQACP-ADCGARFHACKLSEHGLICPNEKAPCINAVNGCPKWMPRGQHARHL-AHC 77
gi 780083080    11 HGHCGSCYSR-DCQVSPQPGNACSLVNCE-VDCGARFHRCKEDEHRLLCPNAKTECVNAIYGCPVDIQRRHICRHL-EVC 87
gi 321460194    10 HAHCESCIKIsKCTKKTIEGESCAIICCQ-RKCGASFHSCKESEHILLCPNVQEPCINVNYGCPHVLLRKHRGKHL-ESC 87
gi 156379861     9 HEHCQNCFKL-YCTSN----EKCKVIACD-SGCCLRMHECKLSEHKLVCLKAKTPCTNSFYGCPAVLPRESIKSHL-SIC 81
gi 241836719    11 HPHCLNCISIvKCNARSEQRKSCQIVACK-LDCGASFHSCKCQEHQLLCPNVKVPCSNAVNGCPASLLRSQLGSHL-QHC 88
gi 195996163    13 HPQCLTCILI-DCQHK----NHCQMIQCNnSGCNACFHACKLTEHKLLCLYENVQCINWYYGCPQTMPRCRLNQHL-TVC 86
gi 954362935   918 cggdvhdehckccfskkckfsQCPMLSCP-NRCCFTMHSCKLVDHLFICQEQEINCLNASIGCPFRLKRKQLSKHLaDQC 996
gi 802700814    31 YSHCSFCIAS-ACRFS-----ACPLTEC--AVCYAVLHECKRDDHQEICRMEMVPCLNSSFGCPLSIRRSLLSRHL-SVC 101
gi 541047194    13 HIHCRYCYKI-NCNYS-----KCKMIICT-E-CSVPLHPCKLDDHLLLCSKARVPCPNASGGCPLVLRRERIGAHL-ENC 83
                           90
                   ....*....|....*.
gi 1005955903  111 PASVIHCYIEWNRWPI 126
gi 260798682    78 PASVVRCTMEWNRWPV 93
gi 780083080    88 PASVVNCTMEWNRWPV 103
gi 321460194    88 PASCLPCNAEWNRWPl 103
gi 156379861    82 PASAIFCTMEWNRYPV 97
gi 241836719    89 PASILSCTVEWNRWil 104
gi 195996163    87 PASIVHCSKKWSRCPt 102
gi 954362935   997 PACVVYCSAGWNRWPV 1012
gi 802700814   102 PASVISCSHERARAPr 117
gi 541047194    84 CASVVFCAVQWNRRil 99
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap