Conserved Protein Domain Family
Nucleoporin_FG2

?
pfam15967: Nucleoporin_FG2 
Nucleoporin FG repeated region
Nucleoporin_FG2, or nucleoporin p58/p45, is a family of chordate nucleoporins. The proteins carry many repeats of the FG sequence motif.
Statistics
?
PSSM-Id: 318232
View PSSM: pfam15967
Aligned: 5 rows
Threshold Bit Score: 676.767
Threshold Setting Gi: 556960020
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690   2 SGFNFGGGn-LGSTn-tGGGFTFGGVPS----------APA--ANAGGLSFGTPLGTaaatPASTTSSTPSLGLGGVLFA 67
gi 556960020   2 SGFSFGGG--AGAG---GGGFTLGAAAAaaaaaaaaagSNP--GSTGGFSFGTLGAA----PAVATTTATTLGLGGGIFG 70
gi 972958899   2 SGFNFGSGggLGSTt-aGGGFSLGAAT-----------SNP--TGTGGFGLGTLGAAtasgTATTTTTASSLSLGSAVFP 67
gi 768930668   2 SGFNFGSGi-LGSSt-tGGGLSFGTA------------ASApaTSSGGFSFGSALGApa-aPA--TSTTTALALGGGLFA 64
gi 765154015   2 SGFNFGSGa-LGATnntGGGFSFGAATS----------APA--ASTSGFSFGTVLGTaaatPAS-TTTTASLGLGGNPFG 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690  68 QKPAGGFSFNTPASTSSA--AATGLTLG-APATTSAA--TGFSLAFNKPTASATPFSLTTt----tSSTTGAGLSFGSIL 138
gi 556960020  71 QKPATGFTLGATNPGTTTa-SSGGLTLG-APAATSAAs-TGFSFGFNKPAGSATPFALPI------SSTSGSGLSLSSVL 141
gi 972958899  68 QKQATGFAFGTPASGTAAtgPVTGLTLG-TPAATTTAstTGFTLGFNKPAASATPFSLV-------TSSAPGGLTLGSSI 139
gi 768930668  65 QKPTGGFSFNTPASSAAA--PTAGLTLG-TPASSAAS--TGFNFAFNKPTASATPFSLTTvatpssSAPAGAGLTFGSVL 139
gi 765154015  68 QKPTGGFSFNTPTSSAAA--PATGLTLGgAPASTAAT--TGFSLAFSKPTASASPFSLTTst---aSSTVGTGLSFGSIL 140
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690 139 TSTApQQPGATGFTL-GLGGMT-TSTAASTVPS-------LGAGLFS--STGTSGLGQ-TLGGGTGltlgsllATSTAAS 206
gi 556960020 142 TSTA-APSGATGFTL-NLGNAPaTATTASTGLSlgstlstLTGALFQnaSTAAPGLGQtALGLTLG-------ASTTAPT 212
gi 972958899 140 ASST-AQTGSTGFAL-NLGGTNlTSAPGSTGLTlgstlagLGSGLFQ--NTAATGLGLgALGS----------ATSSAPV 205
gi 768930668 140 TATApQQPAASGFTLgGLGGAT-T----TTVNS-------LGGGLFS--STISTGLGQtTLGAGGGlnfgtllATSTAPT 205
gi 765154015 141 TSTApQQPAATTFSL-GLGGST-ASTAASTVPS-------LGGSLFS--SSVSTGLGQtTLGAGGGltlgsllGTSTAAS 209
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690 207 AapAPSIGLGGVDFSTSSESKSDASSGTNAQDSKALKDENLPPFICQDVDNFQKFVKEQKQVQEDISRMSSKTISKVQDD 286
gi 556960020 213 S--VASEGLGGIDFSSSSDKKSDKASGTRPEDSKALKDENLPPLICQDVENFQKFVKEQKQVQEEISRMSSKAMVKVQDD 290
gi 972958899 206 A--SAGLGLGGLDFSTSSEKKSDK-SGARPEDSKALKDENLPPVIYQDVDNFQKFVKEQKQVQEEISRMSSKAMLKVEED 282
gi 768930668 206 TapAPSIGLGGVDFSTSSENKNDTSSGTSALDIKALKDENLPPVICQDVENFQKFVKDQKQVQEDISRMSSKAISRVQDD 285
gi 765154015 210 TapAPSIGLGGVDFSTSSENKSDTLSGSSEQDSKVLKDENLPPVICQDVENFQKFVKEQKQVQEEISRMSSKAISKVQDD 289
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690 287 IKSLKQLLSVCASGLQRQGLAIDKLKLETAQELKNADIALRTQKTPPGLQHENTAPSDYFRSLVDQFEVQLQQFRQQIEE 366
gi 556960020 291 IKALKQLLSVAASGLQRNTLAIDKLKVETAQELKFAEIALRTQKTPPGLQHENSAPADYFRALVEQFEVQLQQYRQQIEE 370
gi 972958899 283 IKSLKQLLSVCASGLQRNSLSIDKLKIETAQELKNADIALRTQKTPPGLQHENTAPADYFRGLVEQFEVQLQQYRQQIEE 362
gi 768930668 286 IKNLKQLLSVSASGLQRQGLAIDKLKLETAQELKNADIALRTQKTPPGLQHENTAPSDYFRSLVEQFEVQLQQYRQQIEE 365
gi 765154015 290 IKNLKQLLSVNASGLQRQALAIDKLKQETAQELKNADIALRTQKTPPGLQHENTAPSDYFRSLVEQFEVQLQQYRQQIEE 369
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690 367 LENHLTTQSNGSHITPQDLTLAMQKLYQTFVAQAAQLQSVHENVKILKHQYLSYRRAFLEDSTDIFESKRASNRKWQSAP 446
gi 556960020 371 LENHLATQANSLHITPQDLSMAMQKLYQTFVALAAQLQSVHENVKILKEQYLGYRKTFLGDASDIFEARRAETKKWQSIP 450
gi 972958899 363 LENHLTTQASSSHITPQDLSLAMQKLYHTFVAVAAQLQSVHENVKILKHQYLGYRKAFLEDSTDVFESKRAANKKWESAP 442
gi 768930668 366 LENHLTTQSSGNHITPQDLTLAMQKLYQTFVAQAAQLQSVHENVKILKHQYLSYRRAFLEDSTDVFESKRASNRKWQGTP 445
gi 765154015 370 LENHLTTQSSGSHITPQDLTMAMQKLYQTFVAQAAQLQSVHENVKILKQQYLSYRRAFLEDTTDIFETKRASNRKWQSAS 449
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 551503690 447 QVTTGPAPFSSVPNAAAVAMAATLTQQQQPTPGTQAPLGAGFGNPFASAVGTSLGSSTLgG------FGGGPGFGGVGTG 520
gi 556960020 451 RVTTGPTPFSSIPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFASGIGTGLQSSGL-GssslggFGSSSGFGSSNTG 529
gi 972958899 443 RVTTGPAPFSTVPNAAAVAMAATLTQQQQPATGTQPSLGVSFGAPFGSGIGTGLQSSGL-GssglgaFGSGPGFGSVTSG 521
gi 768930668 446 KVTTGPAPFSSVPNAAAVAMAATLTQQQQPTP--------GFGS----------------------------------SS 483
gi 765154015 450 RVTTGPAPFSTVPNAAAVAMAATLTQQQQPTPGTQAPLGAGFGNPFASAVGTSLGSSTL--------------------G 509
                        570       580       590       600       610       620       630
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 551503690 521 GSSFGFSSTNKPAGgSLSAGFGSTSSSGFNFSNPGINQSAGLTFGVSNQPGSAFGT--TPALQLKKPPAGNKRGKR 594
gi 556960020 530 SSSFGFGSTSKPSG-SLSAGFGSSTTSGFNFSNPGITASAGLTFGVSNPSASTFGTgqQQLIQLKKPPVGNKRGKR 604
gi 972958899 522 GSSFGFAPSNKPSGgSLSAGFGSSSTSGFNFSNTGITASAGLTFGMPSAPATGFGAg-GPLLQLKKPPAGNKRGKR 596
gi 768930668 484 SSGFNFSNP------------GINPSAGLTF-------------GVSNQPVAGFSTg-GTLLQLKKPPAGNKRGKR 533
gi 765154015 510 gfaggpgfggvgcagssfgfstaakpaggslsagmfslrkycpptrlqq--------------------------- 558
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap