Conserved Protein Domain Family
TMEM135_C_rich

?
pfam15982: TMEM135_C_rich 
N-terminal cysteine-rich region of Transmembrane protein 135
TMEM135_C_rich is a family of putative peroxisomal membrane proteins found in eukaryotes. This is the highly conserved N-terminal region that has several highly conserved cysteine residues. The domain is associated with family Tim17, pfam02466.
Statistics
?
PSSM-Id: 318242
View PSSM: pfam15982
Aligned: 4 rows
Threshold Bit Score: 213.96
Threshold Setting Gi: 1005970758
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 971378565    9 PHSCYEIGHTWHPRCSVAVLHVTQGALAESLRIYGTLYLIAAILRKRkLDYY-LHKLLPEILQSTSFLTANGTLYIACFC 87
gi 1005970758  17 PFNCYEVGHTWTPFCSQAALDIGGSVFYEGLKMYTGVYLFGQMMARR-FDYKsFRETVKSILRSSTFLGFNAFAVLVLFC 95
gi 542194817    8 PHNCYEIGHTWSPSCVQSAADVTRSALEVSFKIYAPLYLIAAVLRRRkKDYY-FKRLIPEIFWSTSFLTTNGGLFIVFFC 86
gi 513013828    9 PHNCYEIGHTWSPSCLVSFLQITRDALEESLKIYAPLYLIAAILRKRkIDYY-LYKLLPEILQSASFLTANGAFYIAFFC 87
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 971378565   88 ILRKLLGKFYFWSPGFGAALPASYMAILIERKSRRGLLTIYMANQATETLFRMAV 142
gi 1005970758  96 FSFRSVGKLYLSLIGHLPSIIGSYMAIHLEKPSRRGPLAFYVANIAAETLFQIAV 150
gi 542194817   87 ILRRLLGGFYSWSVGFGSALPASYIAILLERKSRRGLLTIYMANLATETLFRMAV 141
gi 513013828   88 LLRKILGRFYSWTPGFGAALPASYIAILIERKSRRGLLTIYMANLATETLFRMGV 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap