Conserved Protein Domain Family
DUF4776

?
pfam16003: DUF4776 
Domain of unknown function (DUF4776)
This presumed domain is functionally uncharacterized. This domain family is found in eukaryotes, and is typically between 444 and 485 amino acids in length. There is a conserved TLR sequence motif.
Statistics
?
PSSM-Id: 318260
View PSSM: pfam16003
Aligned: 23 rows
Threshold Bit Score: 477.274
Threshold Setting Gi: 568248735
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   335 YKPPNLCQLCRSDISWLPKISACPYCGYKTFEDI-QpsEQPYDLTATAQQLLRDCLRKETCE--LDPSKGDDEAMGDKNK 411
gi 195452618  312 HQAPTLCILCKSDVSWLPKLSACPYCGYRNYNAEsE--EELYDENATAKQILDVHMREDRCR--SDSEEEDDSCTEDND- 386
gi 195108611  330 YTPPLLCSVCHANITWLPKFAACPYCGYKRCDLE-QpsEEPFDETATAADVLRDHMLHTRVS--SESSQRSRFTCSNVDP 406
gi 968096935  330 YTPPLLCPVCHANITWLPKVAACPYCGYKRFEMD-KpsEEPFDESATAAEVLRNHMLRARLG--SEENSQRKHN---SYD 403
gi 968059294  359 VKPERSCLMCHADVSWLPQIAACPHCGYKPLPIF-T--EKEYDESATAKDIIVDFFQQKSSE--S--------------- 418
gi 195452616  403 VNTSRLCHVCKEDVSWLPKIAACPHCGYKPVPLF-N--EKPYDENATADDLLHICLEQQQSEgaLSSDSVH--------- 470
gi 195037401  319 YTPPQICPVCQANITWLPRVSACPYCGYKHYEME-PdsEQPFDETATAAEIVNNHFLNTRGE--Q--------KRSSSPL 387
gi 968096933  253 MKRGHECPMCHEDVSWLPKIAACPHCGYKPLPQF-E--EKDYDETATAKDILDDFFQHIGSE--SKSLDLGS-------- 319
gi 194746132  461 ISDIRACILCGEDVSWMPKIAACPYCGYKPVPDF-K--EKPYDEEATAEKILFDHLDNQ------EDFDMGS-------- 523
gi 195341445  366 ISNTRSCVLCGEDVSWLPKVAACPCCGYKPVPEF-K--ERPYDEQATAQQILLDHLENPVEN--L-SFDMGS-------- 431
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   412 DD---PNVPQQCGCLG-GKPCTRCRIRKLCDNFF-KENECKIEPLPQAY------PQAPSKsqpeskKVNQAN----SDE 476
gi 195452618  387 AN---NTDPKNCGCIT-GIPCTRCRIRKLCESIF-KEKDVNINKPTPAEqn---ePQKETN------ELEKKE----STV 448
gi 195108611  407 AScsaTKITKTCTCKG-GRVCTRCRIQQLCDNMV-----DTKPKSPESK------SPARPL------SPKKTP----STP 464
gi 968096935  404 SI---PKSSKDCTCRS-SRVCTRCRIQELCDQMLsKSSTTKVKSQPQSQ------SQEQVR------TLKKTA----STP 463
gi 968059294  419 ------KISNTNTCR---DFGSESKTEEAFESIV-SDYKSLKQSIKKCK------SIQPCN------K---------TSS 467
gi 195452616  471 -----------------GHPMHEVNSSEALQNLL-RNYEHLKQSIKRAEngeqkkPHATTS------SSKKGP-----TA 521
gi 195037401  388 PV---SLTSKECTCKQvQRLCTRCRVQELCSTT-----------KLQSK------LQPKSE------TVKKAP----STT 437
gi 968096933  320 --------SSGCSKTC-NNQASDVKTEEAFETIV-HDYKSlkqsiKKCK------SAQpc------tSSSKRS------Q 371
gi 194746132  524 --------VEGCPAG--KVNVENDRTSEAFEAVV-RDYQLlkrsiRESS------RMKtc------qPAVEKPtrpdPVE 580
gi 195341445  432 --------VEGCSAD--EEHGVPEPTSEAFEAIV-KDYQLlrrsiRESN------TKAt-------qSATKNPt--aQEG 485
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   477 SLRRTQLISIFTEMRNMFGKK--KG-AN-----EadvvAEELRKECDAACRNTK-SAKARRKARKALQKTLD--E--IDK 543
gi 195452618  449 SQRRSHLIKIFTEMRNVYDTN--KK-KTsqgdlL----DEQMRQELMAHC--GK-SVKLSRARQRSLNKALK--E--IDR 514
gi 195108611  465 SQHREHLLKIFSDMQKVVGGK--PS-AKe----V----ADNVLKQCAEITRKG----KKGRQRSASIKKLLR--E--MEE 525
gi 968096935  464 SQRRNQLVKIFTDMHDAYSDK--KTpKQ-----L----TEKLLKDCEAIASKAK-K-KGRRRQSTAMRCALK--Dl---K 525
gi 968059294  468 KKLPTDLVSIFAEMQKLFEVGe-DD-SD-----K----KLKIKQICDEACKLAK-ASKKHRKYSNK-----------MSD 524
gi 195452616  522 PAGQQNMAAVFTELKNMFKLK--DG-D------A----QAKIQEICQEAQQFSS-KTHQKKGSK-------------IRD 574
gi 195037401  438 SQRCKELVKIFTEMRNFYSDKklDN-KA-----M----TDKLLKDCDKECRKGA-K-KKRHRHTCVMKKALK--D--LEK 501
gi 968096933  372 KKQQTNLVSIFTEMKKLFDDG--C---------DeadkNAKIKEICEDACKLAK-VTKNRRISNSNSK---------MSE 430
gi 194746132  581 EHKPQNLAKVFAELKDLFKAK--T---------AeeakNQKIQDICNDACHLARlRVKKSRSQRNADRKKAGevAgaEED 649
gi 195341445  486 PPQPQDLAKVFTELRDLFNVK--A---------Ad--eNQKIQDICAEACVLAK-SHKKSKKRPPSPERTKAgkAepVED 551
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   544 AYPKPAKM--RIk--kERTHHKKSRCYTFLKLKTVS-KDsRIGHLDCISGS-----KhtgysRIPCHMGWMWTKSEMA-R 612
gi 195452618  515 AYPSPRKPk-KAr--gKSKWRSPSKKYAFWNSKKSD-HGsRIGHNTCISDGsytgyR-----KIPCHMGWMWTKSSMS-R 584
gi 195108611  526 CVPTKRKKksKCv--tRKSKRRKSKRYTFLVRKDTI-RQ-PNTHHTCSQGS-----G-----RVPCHMGWMWTKSELAaH 591
gi 968096935  526 TTYSLKKRkpKCv--kKAKRRTKSKRYTFLVRKDNS-RQ-PSTHHTCSRGS-----G-----RVPCHMGWMWTESELA-R 590
gi 968059294  525 PCAEPKKTkrRKa--qPKFN-VKSKVYA---PMDKLaHP-RLGHTNCFDDG-----R-----MVPGHMGWLWTDNPLA-K 586
gi 195452616  575 QSETSVQKkkQRr--qRKKPNFKSKVYAMIPPSGRC-S--KNNHELNFDGP-----------TVPAHMGWLWTSNPLA-K 637
gi 195037401  502 IYPSKKPKakSQk--kKKRRVK-SKRYTFLVRKDNL-RPeVKTHHSCAREL-----G-----RVPCHMGWLWTASELG-R 566
gi 968096933  431 PCGAPKVR--KRrkmaHKLN-VKSRVYA---PMEPL-THpRQGHVHCHDDE-----R-----KVPAHMGWLWTHNPLA-Q 492
gi 194746132  650 PCTDPKPL--KKrkykTKRP-YKSRYYSMYKPRERP-PRpTSVPEDI---------------QVPGHMGWLWTAHPLA-S 709
gi 195341445  552 ACETPRKT--KKrrpkVKHP-YKSRYYSMYRPTERP-KE----NVAIPDAG-----K-----KVPSHMGWLWTAHPLA-N 612
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   613 HKSWRPGAISRPIRQLMSYFLKDFPADNICLSRY--HYRHKKCRRVEEL--EEPLVQHPTLHISRKGDEYIITLRPLKDP 688
gi 195452618  585 FKKWKPGAICKPIRGLMSYFLKDFPVDTICLSRY--HCRSKKTRKESDAseEENLEQHPTLHISKKNGEYIITLRPLKDP 662
gi 195108611  592 HKSWKPGAIKKSIRELMAYFLKDYPADKIVNSRF--HYRTRKEP--DKCavEEPLIQHPTLHIVKKHDEYTITLRPLKDA 667
gi 968096935  591 HRCWKPGAIKKSIRQLMAYFLRDYPADKIGNSRF--HYRRRRQSP-DQPveEEPLIQHPTLHITKKYDEYTITLRPLKDA 667
gi 968059294  587 LPGWRPGAIRRSIRELMGYFLKDYPVDSIPISKYmsYHKQKPKPSHEMAekPEDLVQLPTLHIEKKNDEYLITLRPLKDP 666
gi 195452616  638 KRGWRPGSIRRSTRELMRYFLRDFPMDTIPVSRYmsYYKQKQPPPSDIKekAEELVQKPTLYIEKKNDEYIITLHPLKSP 717
gi 195037401  567 HRCWKPGAIKKPIREIMAYFLRDYPADRVVQSRF--HYRRQLNQ--NAAdnKEPLIQHPTLHITKHRDEYVVTLRPLKEP 642
gi 968096933  493 RPGWRPGAIRRSIRELMGYFLKDFPVDSIPISKYmsYHKHKKLAPHDReqkPEDLVQVPTLHIEKKNDEYLITLRPLKDP 572
gi 194746132  710 QPGWRPGAIRRSIRDLMSYFLADYPIDSIPVSKYmsYYKNKKPPKTSSakkEEDMTQVPTLHIEKKNDIFTITLRPLKDA 789
gi 195341445  613 KPGWRPGAIRRSIRGLMSYFLKDFPVDNIPVSKYmsYYKHKMLPQSPPgekAEDLVQVPTLHIEKKNDVYTITLRPLKDA 692
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   689 KALASSANPYADMKPVVFRITKDPMAAGLRQMRVNLQDKGFAPCTCRRPVASCFCRSHIEKKRIQYEVENECRQRGWPNN 768
gi 195452618  663 KALAVCANPYADMKPVVFRITKDPKAVKMRELKTGLQDHGFPLCTCQNPIVSCHCRSHVDKERLVYAFETLCERLGLPNT 742
gi 195108611  668 KTLAVAANPYANMKPVVFRISKDPIATGKRNIKLGLNDRGYDVCTCHQPVSRCFCRSHIDQKLLVEDVKILSAEQGWQDV 747
gi 968096935  668 KSLAVDANPYANMKPVVFRIIKDPIATGMRNIKISLKEKGYPVCSCHQPVASCFCRSHVDQKIVAQEVKLLSEDRGWRDV 747
gi 968059294  667 DTLKRAANPYANMKPVQFRIVKNPLLKKVRELKRCLKNMGFSKCKCHRPVMQCYCRSFIDKKQLVDELQRQCAKRELHNC 746
gi 195452616  718 GILEHSANPYVNMKPVQFRIVKNPLLKEIRDLKRCLKGMGFKKCTCHRPVIACFCRSFIEKKQLIDELQKECEQREMESV 797
gi 195037401  643 KTLAKAANPYENMKPVVFRICKDPIAMGKRNIKLALKERGYPVCTCKQTVSKCHCRSHIDKKIFAQDVKMLSEEQGWTDI 722
gi 968096933  573 DTLKRAANPYANMKPVQFRIVKNPLLKQVREMKRCLKNMGFSKCKCHRPVMQCFCRSFIDKKQLVDEVQRQCHMRNMPHC 652
gi 194746132  790 ATLAKSANPYVNMKPVQFRIVKNPFIKELRDLKRCLKGIGFSSCTCHKPVMQCYCRSFVDKKRLIYCLRKECEQRKMDSC 869
gi 195341445  693 KTLARSANPYVKMKPVQFRIVKNPLLKEIRDLKRCLKGMGFSKCSCHKPLMACYCRSFVDKKRLLYHVRRECERRKIDSC 772
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74864496   769 SDTFVY--SpnsD-------DDDSDREYEFGVTPPAGVIKPERVRQ--PDRAHVETQYVDHDWAAPTMYPHPANMLVQYG 837
gi 195452618  743 SDSFIY--S---NdddedddDADSEQEYEFGVTPPAGLVKPERLHH--PDHTNAETQYMEDDWAMPSMFPHPPNPYVQYG 815
gi 195108611  748 SDTFVY--S---Dl-----sESDSDNELEFGVTPPAGIVKPERCNR--PDRVNCETQYNENDWAMPTMYPHPPNAQVQYG 815
gi 968096935  748 SDIFVY--S---Dl-----sESDSDNELEFGVTPPAGVVKPERRRK--PDRVNCETQYNENDWAMPTQYPHPASALVQYG 815
gi 968059294  747 ENELVL--S---D-------TTDSEAEFDFGVTPPAGLMHPERLKV--SHRTNAETQYNENDWALPTMYPHPPNAYVQYG 812
gi 195452616  798 ENALVL--S---D-------TSDSEAEFEFGVTPPAGLIHPERLKKttHHIINAATQYDENDWITPSMFPHPPNRFMQYG 865
gi 195037401  723 GDTFTYsdL---S-------DSDSDDELEFGVTPPAGIVKPERLRK--PDRVNCETQYNENDWAMPTMYPHPASALVQYG 790
gi 968096933  653 ENELVL--S---D-------TTDSEAEFDFGVTPPAGLMHPERLKT--VDVTNTETQYNENDWAMPTMYPHPPNPNVQYG 718
gi 194746132  870 EDELVL--S---E-------TSDSEAEFEFGVTPPAGLMHPERLKS--SHVKSVETQYDEADWAQPSSFPHPATPLAQYC 935
gi 195341445  773 EDELVL--T---D-------TSDSEDEFDFGVTPPAGLMRPERLKS--SHVKHTETQYNESDWVNPSLYPHMPDATVQYE 838

                  ....
gi 74864496   838 GCVM 841
gi 195452618  816 ACVV 819
gi 195108611  816 GCVI 819
gi 968096935  816 GCVI 819
gi 968059294  813 GCVI 816
gi 195452616  866 ACVV 869
gi 195037401  791 GCVT 794
gi 968096933  719 GCVV 722
gi 194746132  936 ACVM 939
gi 195341445  839 SCVM 842
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap