Conserved Protein Domain Family
NUSAP

?
pfam16006: NUSAP 
Nucleolar and spindle-associated protein
This family of microtubule-associated proteins has a role in spindle microtubule organisation.
Statistics
?
PSSM-Id: 318263
View PSSM: pfam16006
Aligned: 21 rows
Threshold Bit Score: 214.949
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74717631   160 GKKSLYTdESSKPGKNKrTAITTPNFKKLHEAHFKEMESIDQYIERKKKHFEEH-NSMNELKq----------------- 221
14_pfamImport   2 GKIPRYT-RLNQSGKTG-IKPTTPNFKKLHEAHFKKMESIDLYIKRKQNRIEAFnNSVKEVKvlaenanllkpi-----q 74
17_pfamImport   1 --IPLHSgRASRPAKMG-MTATTPNFKKMHEAQFKKMESIADYVERKKKLNENCsA----VKvltrksntlrv------s 67
5_pfamImport    3 QKIPLYVgGVSKPGKTG-LKATTPNFKKLHEAHFKKMESIADYIERKKKMLENCsSSLNEAKk----------------- 64
gi 158563870  181 GKIPRLAgRLSKPG----SKPSTPNFKKLHEAHFKKMESIDKYMERKQKRLDAVsSSIQEVKmltkksnllksv-----e 251
gi 158513160  159 GKIPRHKgLMKR--KPA-MRPTTPNFKKLHEAHFKKMESIDSYVQRKNKQMEVLrNSVKELKtlsektlkk--------- 226
16_pfamImport   3 GKIPRHQgLQQR-SKAL-LKPTTPNFKKLHEAQFNKMESIDSYVQRKTKQVETYkNPVKDLk------------------ 62
8_pfamImport    3 GKIPRYQgQQQK-NKAS-LKPVTPNFKKLHEAHFNKMESIDTYVQRKTKQLETTkSSVQKTKiltsrstltksrqrskgd 80
gi 972980169  188 GKIPRHEgLMKRMGKAV-LKPTTPNFKKLHEAHFSKMESIDSYVQRKNKQIEAYkSSVNEVKmlsekanilkls----dk 262
gi 637244647  180 GKKP-YKgNLPKSGRRG-T-PTTPNFKKIHEAQFKKMQSIDEYIEKKKKMICNVsNSVKEDKiltknnnpqkss-----k 251
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74717631   222 ---------qPINKGGVRTPVPPRGRLSVASTPISQRRSQ-GRSCgPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDN 291
14_pfamImport  75 ktegsnttklGSAAMTMFSPPSQRGRRFTVCTPGNLRQSP-RISM-SANKNILRETDKFKPTVLSTTKMNVRFSEATRDN 152
17_pfamImport  68 ekdiphskkqSSGKRFLFSPNPERGRFSNIATPSNLRRSP-RNSLnTANRSILSRKSSFHPSVLSTSKMNVRFSEATKDN 146
5_pfamImport   65 ---------hTSGKTLLFSPNPERGRFSGTCTPSNLRRSP-RGLLnTGSQSILSRKSLFNPSVLSTTKMNVRFSEATKDN 134
gi 158563870  252 ktpvsdikkpVKSRLSLLSPLPRTTGASPSRTPMSQRRSC-RSS--TASKSILVDRSGFKPSVFSSSKMNVRFSEATKDN 328
gi 158513160  227 -peakaqtkvPSSRASLFSPAVQ-----KTAVPERRRLTQq-----PVSKSALKDTATFRPTVLTTNKINVRFSQATQDN 295
16_pfamImport  63 ---------kNSARATMFSPVPGNKTPAEE----NLRHTL-KASKiPSKKPAQKEDGQFRPSVLSARRVNVRFSEATLDN 128
8_pfamImport   81 gaesfflqkaSWSRTSLFSPVSVDTRPAAD------RRTLpSASKaPANKPPGKEDAPFRPSVLSTRRINVRFSEATRDN 154
gi 972980169  263 rtpstlatkpSAGRVSLFSPNSKDRRPTTSIPSPRRRPTQ-T----SASKPALREASSFKP-VLSARRINVRLXXXTKDN 336
gi 637244647  252 ketlkscskmCSS-GVLFSPHNQKNRLSPTCTPI-LRRSP-RNFPgT-SKNILSQKSAFSSTDLSATKTNVRFSESTEDN 327
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74717631   292 EHKRSLTKTPARKSAHvTV-SGGTPKGEAVLGTHKLKTITGNS------------------------------------- 333
14_pfamImport 153 EHKCSLFKTPARMSPY-AD-LPNTPGTEESKLKKTEEKSAKKCptskcswsppphpenccpfalkhsriyrgrtrnkssl 230
17_pfamImport 147 EHKRSLTKTPSRMSPY--T-EICTPDTQKSCKLRSQKNSKGNArnnd--------------------------------- 190
5_pfamImport  135 EHKRSLTKTPSRMSPY-VE-EICTPDSQKSCEPLNAKNSKRSTrnnd--------------------------------- 179
gi 158563870  329 EHKRSLIKTPARKSS--SF-LAVTPESEPRRILPSVRKTELLPapekadkpdvnitl----------------------- 382
gi 158513160  296 EYKRSLVKTPARMSPH-MP-LTSTPGRKSDVRSKAELNRSASTit----------------------------------- 338
16_pfamImport 129 EFKRSLVKTPARMSP--CV-ASSTPQKPTADAAKPAAAKSSALsa----------------------------------- 170
8_pfamImport  155 DNKKSLVKTPVRMSL--CV-TSSTPNKPATNEGKPRSSKISTLsa----------------------------------- 196
gi 972980169  337 EHKRSLVKTPARKSPY-TVaESSTPGAGPAKRATSESNKPGGP------------------------------------- 378
gi 637244647  328 EHKRSLTKTPSRK-PQ-FL-NGCTPDTQKSNEGVVTRKNIARS------------------------------------- 367
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74717631   334 -------------------A-----------A----VITP--FKLt--------tEATQTPVSn-KKPVFDLKASLSRPL 368
14_pfamImport 231 vsciqsssfilervnfkstT-----------S----GITP--LAL----------PNSETPGR--KKNAFDLKASLARPL 281
17_pfamImport 191 ----------------ltaP-----------K----VLTP--FKFg---------AQSAEPTS--GKKTFDLKASLSRPL 226
5_pfamImport  180 ----------------lpaL-----------K----AITP--FKFa---------AQSAEPSS--TKKIFDLKASLSRPL 215
gi 158563870  383 -----ntttqpspatgmsaC-----------K----AITP--FKFt--------aQNTETPNTk-KKGKFDLQASLSRQL 431
gi 158513160  339 -----------------------------ktP----GATP--FVFng------nnSISTTPGTt-KKNTFDLKASLSRPL 376
16_pfamImport 171 ------------------------------------qkTPgpFIFtg------ntSALGTPGTq-KKPAFDLKASLSRPL 207
8_pfamImport  197 ------------------------------------tkTAgtVCLlirrnksgntSTSTTPGTq-KKAGFDLKASLSRPL 239
gi 972980169  379 -------------------A-----------ShskvQVTP--FVFkgd----antSISDTPGTnvKKNAFDLKASLARPL 422
gi 637244647  368 -------------------AtkcqlkeaqrnS----SVTL--FKSv--------sDTAELT-St-KKPVFDLQASLSRPL 412
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 74717631   369 NYEPHK-GKLKPWGQSKEN-NYLN-QHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGL 436
14_pfamImport 282 GYQPHKvGKLKPWGDSTENaTALNkSLGASYDSLKKNYKQPRLQTREERRQKHNEYRQQKKENAIAAKRGL 352
17_pfamImport 227 RYQPHK-GRLKPWGEFKEN-AVLSrSGGSNICSRKKDYKQPHLQTREDRRESLEQDRKKKRTCALGKRRGL 295
5_pfamImport  216 RYQPHK-GRLKPWGELKEN-APPKkSVNSSITSHKRDYKQPHLQTREDRREKHEQERKKKKTQALGNRRGL 284
gi 158563870  432 GYQPHK-GKLKPWGESKEN-KP---DPNSNVSVLKNNYKQPHLQTREDRRNQHVQNRKNKRDQALGTRRGV 497
gi 158513160  377 TYKPHK-GKLKPFGDAQEN-TA-LnKSQTV-PSHQKNYKQHQVQTREERRVKHTEDRKQKKEKMLGARRGL 443
16_pfamImport 208 SYQPHK-GKLKPFGDVKEN-AA-GnKSAIA-NPRQESYKQPKIQSREDRRTKQVESRKQKKENMLGARRGL 274
8_pfamImport  240 TYKPHA-GKLKAFGDNQEN-TA-AnKSLVS-NSHQKNYKQHQVQTRGERRARHVEGRKQKKESMLGARRGL 306
gi 972980169  423 SYQPHK-GKLKPFGVIQEN-APLL---NKSQNSHQNNYKQHPVQTREERRTLHTKDRKQKKDKLLGTRRGL 488
gi 637244647  413 NYQPHR-GKLKPWGNSKEN---------QSICSHKRAVKQPVLQTREERREKLVQERKQKKDQMLGNRRGL 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap