Conserved Protein Domain Family
SAP130_C

?
pfam16014: SAP130_C 
Histone deacetylase complex subunit SAP130 C-terminus
Statistics
?
PSSM-Id: 318271
View PSSM: pfam16014
Aligned: 6 rows
Threshold Bit Score: 598.087
Threshold Setting Gi: 528482392
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 847162289  595 AQGSSPRPSILRKKPATDGLSVRKSLIPPHPGDAVSPRQDSSLRSTSASPRPAGAKPKADLHVPVAPGVTGDPGA----- 669
gi 612018437  634 AQGSSPRPSILRKKPATDGMAVRKSLIPPQPPEVTSPRVESSIRSTSGSPRPSGAKPKPEIHVSMATPVTVSVEAvsnqs 713
gi 973185769  644 tLISSPRPSILRKKPAGEGSAVRKNAFPSQAAEATSPRLDGAIRSATGSPRPAGAKSKPEIHVAVTPPVTVTVEAmsiqs 723
gi 542223612  634 TLVSSPRPSILRKKPANET-CVRKNLIPAQ-TEASTGRIDSGVRG-AGSPRPAGVKPKAEVHMAVAPPVMATVEAlpsqg 710
gi 528482392  650 TLVSSPRPSILRKKPVTEG-AVRKCLIQAQPSEPNAGRVDSGIRL-SGSPRPAGVKPKPDIHVAMAPPVMAAVEAlvghv 727
gi 597762332  632 TLVSSPRPSILRKKPAGEGAGVRKNLIPAQLGDP--GRMDVGIRGTSGSPRPAGVKPKPDILVGLAPPVNPAVEAltgqn 709
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 847162289  670 ADQPNAAAsLPSSHhpaAAVP------S--PPSQPAS--GPIPSSIHITPAt---IPALSAPP--PLLSN---APS---G 728
gi 612018437  714 SDQPTIAV-QPTSQqppPAIPtiiaaaS--PPSQPSValSTIPGAVPVTPP----ITTIAAAT--PASSTvggSLStvmG 784
gi 973185769  724 SEQQAAPS---PAQhpsQAIPailtaaAaaPPSQPTAalAALPAAMAVTPPipasLANVVAPPtqPAASS---TAAcavS 797
gi 542223612  711 GEQQVVSS---NTQhltQAIPtmlatpGpvPPSQPSTvlSSLPAAMAVTPPvpasMANTVASPtqPAASS---TPAcatS 784
gi 528482392  728 GEQQTLST---PVQhhsQAIPtllappApaPPSQPTAvlSALPATMAVTPPvpasMANAVASPtqPAASS-----TaalS 799
gi 597762332  710 PDQQQNSA-LPPSQipaQPVSslltsaT--PTSQP------VPAAMAVTPPip-sMANVVAPPshPGATS---TAAcpiS 776
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 847162289  729 AVIPEAKVKEEAEPMDISRpv-sVP-PLPPNSISSPLTVLANNISIPA--GELLPGASPRKKPRKQQHVISTEEGDMMET 804
gi 612018437  785 PAVPEIKIKEEVEPMDIMRpvsaVP-PLTTNTVSPSLALLANNLSMPP--SDLPPGASPRKKPRKQQHVISTEEGDMMET 861
gi 973185769  798 SALPEIKIKQEVEPMDTSQq---VP-SVTPTVVAPVLTPLGNSLGLSA--GDLLPGASPRKKPRKQQHVISTEESEMMET 871
gi 542223612  785 SVCPDVKIKQEVEAMDTSQ-----PdPNTSMSAAPALTTQTSTLSTPAt-GDLIPGASPRKKPRKQQHVISTEESEMVET 858
gi 528482392  800 STLPEVKIKQEAEPMDTSQa---VPlAPSLTGPAPSLSSQSSTLTVSSqpGELLPGASPRKKPRKQQHVISTEETEMVET 876
gi 597762332  777 STLPEIHVKQEAEQMDTSK-----P-------VGPAPPSGTPALAVPS--ADLTPGASPRKKPRKQQHVISTEESEMMEA 842
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 847162289  805 NSTDEERChAVKPLTSRPEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKLTLQE 884
gi 612018437  862 NSTDDEKS-TPKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQE 940
gi 973185769  872 NSTDEEKS-TARPLAMKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDIRVKEEKKCTLQD 950
gi 542223612  859 NSTDEEKT-PGRPITGRAERRESPPREYVDEEGVRYVPVKPRPPITLLRHYRNPWKAAYHHFQRYSDIRVKEEKKGSLQD 937
gi 528482392  877 NSTDEERA-SSRAPGNRMERHESPPREYVDEDGVRYVPVRPRPPHTHLRQYRNPWKAAYHHFQRYSDIRVKEEKKGSLQD 955
gi 597762332  843 NSTDEERV-LTKPPSQRPEKRKSPPKEYIDEEGVRYVPVRIRPPVTLLRHYRNPWKAAYHHFQRYSDVRVKEEKKGSLQD 921
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 847162289  885 VANQKGITCRVQGWKTHLCAAQLLQLIKLEQDVFERLTVLQEGLIPKKKTATDDDLHRINELIQGNMQRCKLVMDQITES 964
gi 612018437  941 IANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTTLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEA 1020
gi 973185769  951 MANQKGVVCRAQGWKIHLCAAQLLQLTSLERDVYSRLTTLQEGLIPKKKAGADDDLHRINELIQGNMQRCKLVIDQITEA 1030
gi 542223612  938 MANQRGVACRAQGWKIHLCAAQLRQLSSLEHDVYSRLSTLQEGLIPKKRAGADDDLHRINELIQGNMQRCKLVMDQVTEA 1017
gi 528482392  956 MANQRGVACRAQGWKVHLCAAQLLQLSNLEHDVYSRLTTLQEGLIPKKRAGADDDLHRINELIQGNMQRCKLVMDQVTEA 1035
gi 597762332  922 VANQKGVVCRAQGWKIHLCSAQLQQLTNLEHDAYSRLTTLQEGLVPKKKSGGDDDLHRISELIQGNMQRCKLVMDQITEA 1001
                         410
                  ....*....|....*....
gi 847162289  965 RDCMLKVLDHKDRVLKLLN 983
gi 612018437 1021 RDSMLKVLDHKERVLKLLN 1039
gi 973185769 1031 RDAMMKVLDHKDRVMKLLN 1049
gi 542223612 1018 RDTMMKVLDHKEKVLKLLN 1036
gi 528482392 1036 RDTMMKVLDHKDRVLKLLN 1054
gi 597762332 1002 RESMMKVLDHRERVLKLLN 1020
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap