4M8R


Conserved Protein Domain Family
DUF4784

?
pfam16023: DUF4784 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF4784)
This is a family of uncharacterized proteins from Bacteroidetes.
Statistics
?
PSSM-Id: 318280
View PSSM: pfam16023
Aligned: 8 rows
Threshold Bit Score: 543.541
Threshold Setting Gi: 524529198
Created: 11-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8R_A         4 KDGPSKKILVTNAGVTEANQTVKPGDIVHIYGDGFQEGDQVDFDFRWDLGE-P-LFP-EGYLGPVGAEIVERHSNGXSIR 80
gi 392682463  20 DDKEKQPAFVTNITISDAGKTFNPGDAVTVKADGLQSGDQIILDIYWPIADnP-LFP-EGYSRYTRAVTTEQTTNSITFL 97
gi 504589487  52 SDDGEGIPFVTDVVMPSEARTFAPGDEVTVSAKGFEAGDDIMLRIAWPLTN-A-AIS-EGYADGVWGVVTSRTESSITFL 128
gi 524205776  25 KDGPSKKILVTNAGVTEANQTVKPGDIVHIYGDGFQEGDQVDFDFRWDLGE-P-LFP-EGYLGPVSAEIVERHSNGMSIR 101
gi 524529198  25 fksvdnVVFIQDARLEEAGQTLSPGDAFHLHGIGCQQTDNVMLTFTWETGD-A-TIP-VGKVSGIYAKKQDVTPVGITAV 101
gi 494934855  19 KDEDKEPILVTDIVMPTQ-TSFNPGDKVTISAQGFQPGDNFMFEIYWPLPD-QpAMNyQGYALGVSPVMVEQTATSITFL 96
gi 763174359  19 SDKDRVLVFVKNVVMPPDSWVFAPGDGVTVSAEGFEADDEIMLEIHWQESA-EgFAP-EGYAKGVRGIVTVRSATSVTFL 96
gi 81444506   20 DDKDEQPILVTNVVMPASGTVFKPGEKVTIMAKGFQDNDEIMFDIRWPLQD-E-VLH-EGYAKGGRGVITEKTATSITFL 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8R_A        81 XPYRKPESRVEIFLNRASERXSLGKVLLADGQTPKDFRLYGINETD-----KT------IERAYAEETVTGKKTWDXSAH 149
gi 392682463  98 APGHWPASRVEMFLERAGQLQPLGQISVADGQSPEEPYLYGITNSHaiytpTVpr---gITRIDLVTQEISEVIQFHDDE 174
gi 504589487 129 APGGYPAGTAEVKLFRRGKAMPLGRISVSDGTPPASYTLYGVCNDD-----TGev---aISEFDMQTGEIVRTERFPGSH 200
gi 524205776 102 MPYRKPESRVEIFLNRASERMSLGKVLLADGQTPKDFRLYGINETD-----KT------IERAYAEETVIGKKTWDMSAH 170
gi 524529198 102 LPYRYPAADVEVSVMREGKLQKIGLLRITDGQSPKELRLYGVSHVS-----CK------IDGFMLDMNNSCQKSLEVALP 170
gi 494934855  97 APGHYPASKTKIRLRRSGDIMTLGEIAVTNGEAPKEFQLYGIVNSH-----SStgynncIEHVNLTNGTPTNIVGLTEDQ 171
gi 763174359  97 APGHYPASTVRVLLLRRGRMMPLGKIRVADG-TPKAEALYGISKSD-----TDet---lIERIDLSTGGVTRVATLGIGR 167
gi 81444506   97 APGHWPASTTEILLRRSGQMMSLGKISVADGQAPKDFQLYGIINSR-----SNthrphaIEYINLEKPQTAEIVRLADNQ 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8R_A       150 pDFRSVVNLQKTYGLCGLAEENGVQQPFFLDFCTGEWKALSFydYNTLALVIGSGNDIAAIQQRGKGYSLYNVSAGLeqs 229
gi 392682463 175 -DFHLAANIPGTNILCGIREKDGSSFIDGYDLCMHYWCNPVE--RNAITICSDFNNTVSLEMAGDKLLTYCSISYPV--- 248
gi 504589487 201 --FIHPVNRPGSNCIFGLSLDGGKRSAAFYDLTMRYFRNSGG--DRVVTTGVLPNSEAAYLLCEDNYCIILGMT------ 270
gi 524205776 171 pDFRSVVNLQKTYGLCGLAKENGVQQPFFLDFCTGEWKALSFydYNTLALVIGSGNDIAAIQQRGKGYSLYNVSAGLeqs 250
gi 524529198 171 eNLHSVINVPRSYGLCGISGKDGHRTAVCVDFFTGEVKTRAI--D-VMALFLTPSNAAVAVVCHDGICALQTLPIEIga- 246
gi 494934855 172 kDFSCVANVPETQNLCGIQTKDGVRSVFSYDLSMRFWQDMGL--KNILTLCNGQSSIIAVKQISDNEMMLASIGSWP--- 246
gi 763174359 168 -GIACAVGLPGSGWIYGVCSG----SMAGFDLTMNYYDDFGY--RNYLFAGQVTDSSVGLISHDAGRLTLTTRS------ 234
gi 81444506  172 -DFSCVVNLPGSWSLSGVWTKDDRRTTGLYDLSMNYWEKPGA--DQLVTMGIATANSVFGVYQGGDRLFVKTVNVMP--- 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8R_A       230 nyATKTRSNFPxP-EPQFELPEGFTPEQFGDYPGVfXqG---NEIILLSARKGNGKWVPXLYNYr----nGFYVLEGIEA 301
gi 392682463 249 --YTRLNMPPI-H-TPEIPLPDGLKPESLSRYPGV-I-A---DAHMLLSANNGDGTFSPVVIDIak---eKMHCYDPIKA 316
gi 504589487 271 --ETRTSVVVP----PSWRMPEGIGAGMLTGSPFVmN-S---DGYVMLSVNNAEGCYTPMVFGMrsa-gaEARLGDPVYA 339
gi 524205776 251 nyATKTRSNFPmP-EPQFELPEGFTPEQFGDYPGVfMqG---NEIILLSARKGNGKWVPMLYNYr----nGFYVLEGIEA 322
gi 524529198 247 dyMTKSDALGP-V-QPTFAMPDGLKPEYFGNYPGVfI-GteeSSSYLLSANKGNGNWTAVMLdk-----eGFHIMEDIAA 318
gi 494934855 247 --YTRD--IDQ-TlNYRYELPADIKPEALTRYPGVq--G---DSYLLLSADNGNNSFTPVALSLdps-srKVYTGESIQA 315
gi 763174359 235 --ATRSPSPAP-V---SWQVPDEV-VQTLAVQPFVr--V---GSDLLLAQRNADGTCAPLVLRVy----gGAGPGEAVGA 298
gi 81444506  246 --YTRMYVPEK-P-DYGFLLPEGMKAEALSRYPCIqM-S---DGNILCSADNGDGTFSPVVLNGqnieekSIYVGEPIEA 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8R_A       302 DAIIPFYfgXALPDSGSPSLLYQKkVGYXIYY--S--Sgd--nrGSSFRLLEPDKESsklqLQEPFAQLSDKKVVSIT-- 373
gi 392682463 317 EALIPFR--IMEPSPENPNSLQCK-GGYIVSRanG--G------DTQFCLWDTTAGN----LKEPFATYPNAVRSAAMyy 381
gi 504589487 340 DGMIPFW--IVESASDAAGPKHSVcCGYAVVK--D--G------ATELRLYDPVAMT----FGEVLAAVPAAVRSVTAvt 403
gi 524205776 323 DAIIPFYfgMALPDSGSPSLLYQKkVGYMIYY--S--Sgd--nrGSSFRLLEPDKESsklqLQEPFAQLSDKKVVSIT-- 394
gi 524529198 319 ESLIPFR-----AGSDA---------GYIATY--G--G------LSLFRLVNPENGT----IGQAIYTCKIGQIISATsn 370
gi 494934855 316 TALIPFW--TIISGKDTGTTKYVRtGGYAVVR--AddG------RTDLCLWNQATIS----LEEPFATFPNSARSV-Tml 380
gi 763174359 299 DAMIPFW--TVVASADEPD-RMVQaGGYAVSA--G--G------KTQLRLFNAAGDGa---FGETLAEVPGTALSV-Tey 361
gi 81444506  318 VALIPFW--IVKPVEGMGTAKYTRvGGYIVSK--RngAtitegdGTEFRLWNPTTKM----LDEPFTTFPNAACLVATlv 389
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
4M8R_A       374 -NRLDRIgTITVLFSDKEKGRTTSDFDWNSKEWTD-----YTdlSDXPYNSVVWA 422
gi 392682463 382 sKDGQTR-KLYVQFAGYREGDFIETYDFQTKEWRM-----FM--FYVPFAEILLA 428
gi 504589487 404 fPDSDIQdRIYMLCDLGDGGSRVQVYDRAAKSLDI-----FS--GTVYCTEIVLv 451
gi 524205776 395 -NRLDRIgTITVLFSDKEKGRTTSDFDWNSKEWTD-----YTdlSDMPYNSVVWA 443
gi 524529198 371 sEK-----PGHILLNVSETSNGLQIYDLAWNDTKSlshitLPn-SANDYAEVLMA 419
gi 494934855 381 aKDTETL-KLYVLFDTNRGGRLIYAYDLVSKSWQA-----VPg-IGYPYSEIVMA 428
gi 763174359 362 aPDKDSL-EIYLLCE-ADGMRRIHVYDALKKTQRT-----LP--GEFGCSEIVMA 407
gi 81444506  390 sDDFKKQ-ELYVLFDGSRNGRLIYVYDLLKGSWES-----LYpgGGFPYSEIVLA 438
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap