Conserved Protein Domain Family
DUF4790

?
pfam16037: DUF4790 
Domain of unknown function (DUF4790)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 134 and 191 amino acids in length. There is a single completely conserved residue C that may be functionally important.
Statistics
?
PSSM-Id: 318293
View PSSM: pfam16037
Aligned: 18 rows
Threshold Bit Score: 98.5322
Threshold Setting Gi: 642923996
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74869184    92 LHPSYDIKHFQYDLNCYVRYLDSKAKYDRQFLHEMEHIIANQRNICDQFFLKKILCYKTMWP--PLHTKRELNNFVSKFF 169
gi 170065198   30 vYPDYSKFQVTYPVVCRQRYHQDKVRYDKQFQYELKMLELMQNSAYDSMRFHRHVAITTLWP--PLHTKKEIEYVLDKFF 107
gi 195157324   98 QHPSYNIMSFSYDLNCYVRYLEAKEKYDKHFHDEMQYFIDTQDRAINQFVLRRILCYNSRWP--PLHSKREINRFVTKFF 175
gi 195095986   95 RHPSFSMKKIDYQLECEMRYAENREKYNAQLNREMEFIISSKQMIYDQYFTRRVLSYTTLWP--PLHTKPELDIFIKKFF 172
gi 390179343  102 QQPSYSKFKSPLESQCLSRYKECTIKYNRLFKNEMRKLIDYQCSAIEAAYLVRVMAFTTLWP--PYHNESEIDSTSRKFF 179
gi 969469309  126 RYPSYSNFKVNYSYVCLHRYSKARRDYEAQFQKEIANLINFQSTAVDMFSLVRNMAYTSLWP--PLHNEAELKYTHDKVF 203
gi 642923996   27 KDPSYTNLEVPYRVICRQRYQKAGTQQRLQFLREIRRQEISQSKALSGVRIHRVFLNPVLVPanPVEIVK---------- 96
gi 968071551   40 RTVSYSNFHIPLRIRCLANYKRAKRKYEEQFQKEITNLVDYQTSALEACQFVRMMSYLTLWP--PLHTSKELHLTTKNFF 117
gi 1000205334  31 IYPNYSKFKVTYPVVCRQRYHQDKLRYDKQFEYELKMLELMQNSAYDSMRFHRHFAITTLWP--PLHTRKEIEYVLDKFF 108
gi 194759226   39 QRPPPDEKEVTYSDVCRKRYAASFRRYNERFRREMAKHEEMQRCAIDAMRVHRTFAITTLWL--PLHSKREINSTLETLE 116
                          90
                  ....*....|....*.
gi 74869184   170 Q-LPPKEKRRVEYLLK 184
gi 170065198  108 R-LPDKQTRRLRDIMN 122
gi 195157324  176 Q-LTPKQKDRLHYLMK 190
gi 195095986  173 Q-LTSAQKKRLNYLMN 187
gi 390179343  180 R-LTPKEQKRFTKItg 194
gi 969469309  204 Q-LTKKEKKRYKKIMS 218
gi 642923996   97 --LTPKQKFKLEQLLN 110
gi 968071551  118 K-LDKEEESRFKKIMS 132
gi 1000205334 109 R-LPDKQTRRLHDIMN 123
gi 194759226  117 QvLTAKERRRLQEILK 132
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap