Conserved Protein Domain Family
TMEM72

?
pfam16054: TMEM72 
Transmembrane protein family 72
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 145 and 275 amino acids in length.
Statistics
?
PSSM-Id: 318306
View PSSM: pfam16054
Aligned: 10 rows
Threshold Bit Score: 169.87
Threshold Setting Gi: 350536723
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224052532   2 QHKAFWNALEYTCRLLGIATAAVLIGVGTETLQRGQfKSLAFYLLFSGVAVTVCEGFFFISLFLEMCFTHKPEFLAQAFW 81
gi 741904553   2 KQQVFWTGLEYTCRLLGITTAAVLIGVGTETFLRGEfKSLAFYLLFTGAAVSVSEGAYFVAQLLSVCFQCQPGSLAYRAR 81
gi 847147795   2 QCSKGWAVLDGICRFLGISTAAVLTGVGIETLQQAQfPSLGYYLLFCSGILFVCEGSFFLHIFLTSCFRCQAEPRLYVCL 81
gi 321470764   9 CWTIFLQNVELVTRIWGVFTSIVLVGVGVDLCFIHQ--LAGGFAIAAAVITLFLETSWAVTVLLQVCLRYEHHP-IFNCW 85
gi 350536723  16 KTASILGKLVHVIRIFGVFTAIVMFGVGVDIAIHH--HEFGLYIMLMSLLVFFLEITWAITLFLNVCIKNEFSP-IFNFW 92
gi 357626415  32 IESKLWDLLQPVARLWGLITAIVLSGAGAELTVLG--YEVAPALIAGAILVFLLETMWVVALFVDLLCRRGEYSMKLRCW 109
gi 156376449   8 DRSFFWRHFTTFTRILGLATCVAMWWVGILLIDKPD-KRIAVYLLITGASISFLEIIF----IIDKCACCKEGSFGFSLW 82
gi 115313068   2 KGSALWVIVECSCRVLGISTAAVLCAVGIETQSQGEfTSLAVYLLLSSLVIMIFEVAYFIDALLATCLPCPPTWKMFILW 81
gi 742180733   2 KQQVFWTGLEYTCRLLGITTAAVLIGVGTETFLRGEfKSLAFYLLFTGAAVSVSEGAYFVAQLLSVCFQCQPGSLAYRAR 81
gi 637338204   2 RQVTFWNVLEHICRLLGISTGAVLIAVGTDTLLQGQfKSLAVYLLISGIAVSVCEAAYFASLFLAIGSIPKIGSMKYICW 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 224052532  82 KRARCPGSFQKFLGYTLLSVACFLHPVLVWHVTIPGSMLVLTALAYFLLSKRRKSPghkdmhpqagqyvdpstteaapti 161
gi 741904553  82 EKARWLGCFQRFLAYMLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKSKpaaevlappeqytdpsssvvsttg 161
gi 847147795  82 GKTGRMGGFQKFVGYGLLSVACFLHPVLVWHVTIPGTMLIVTGMAYLLLSKRKKFDkefitqaecysdpsrt--aiemtr 159
gi 321470764  86 DAVLWLDHLKRTVIYTILAVLLFAQPHRAWFTTVGGLMLIALGLLHAARWYRKLKS------------------------ 141
gi 350536723  93 EIVLWLRLWKKSLLYTVFSLVFFLWPHGLWLSNIAGALLLWLSFLYVVITFKDFVQ------------------------ 148
gi 357626415 110 DFMRWSCGRARAPFYACAATA-ILFANLTILATVSGGMLLVLAALRATVPFSPYASh----------------------- 165
gi 156376449  83 KFLRAFDNWKKFLLYVVLSSVCYLHPTEYWQGLVVGVMLDILAFFYLIRTFRKKNE------------------------ 138
gi 115313068  82 KKMAKVGGFQKFLYYTMMSVMCFLHPVLVWHAVIPGIMLVVTGFFNFILSKKKKSDvpkesrvfygdpalss---vcvkd 158
gi 742180733  82 EKARWLGCFQRFLAYMLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKSKpaaevlappeqytdpsssvvsttg 161
gi 637338204  82 KQARRRGAFQKFLAYVLLSIACFLHPVLVWHVTIPGTMLVITGLVYYLLSKQKKETttnrqeqhcdpydgtv---vtasv 158
                        170       180
                 ....*....|....*....|....*...
gi 224052532 162 igdteqtytfHGAQREQHRSLLGHMKSI 189
gi 741904553 162 sgdteqtytfHGALKEGPGSLFIHMKSI 189
gi 847147795 160 agdteqtytfNSNLKAKKDSLLTQMRSI 187
gi 321470764 142 ----------------VPMSLIEQQEDG 153
gi 350536723 149 --------------KRSDFVIVPKGQAS 162
gi 357626415 166 ----------GPHSPRAGSTLLSQHDSN 183
gi 156376449 139 ------------------REAYKYRQLE 148
gi 115313068 159 rgdsedtfsfFNVISGKRASFIPNNSRI 186
gi 742180733 162 sgdteqtytfHGALKEGPGSLFIHMKSI 189
gi 637338204 159 ddtgqtytfcREVHKEKHRFTLLDLKSI 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap