Conserved Protein Domain Family
DUF4800

?
pfam16057: DUF4800 
Domain of unknown function (DUF4800)
This presumed domain is functionally uncharacterized. This domain family is found in eukaryotes, and is approximately 310 amino acids in length. The family is found in association with pfam02138, pfam00400. There is a conserved RDN sequence motif.
Statistics
?
PSSM-Id: 318309
View PSSM: pfam16057
Aligned: 21 rows
Threshold Bit Score: 285.014
Threshold Setting Gi: 992220709
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 984106967 1550 YILLEDPQLHAQAYVKLHTLLQTAVPARREEACYVLSKLEAALGRALNtsssetanepasaatA--ASERCSWLVPLVRT 1627
gi 573896133 1622 YIQQQHSQVFAMACVKLHSLLQTVLCLVWEEVCFLLGRLGAPLLQALE---------------EggRAEAFSQLVPIMRT 1686
gi 260807311 1501 FAGQDNNDVCATASAKLHTLLHSRPLHSTEEACYILGALDQAMIKSIE---------------N--HSDAYSFLIPLVRA 1563
gi 699246083 1511 CIKTNNLEIVAMASAKLHNLIHSREPASTKEVCYLLEGLHESVCHSIV---------------E--DSNVKEFVVPLIRD 1573
gi 405951241 1622 YASQPDLELCAVATAKLHTLVQTKLISSSAEASFLIGNLNLMVLKAVR---------------E--SSDTYSFLIPVMKA 1684
gi 699603957  186 YIMLQDPQLHSLAYVKLHSLLQTASAPKKDEACYLLGKLETPLRRSLD---------------T--KSETFSWLVPIVRT 248
gi 768922061 1683 YIKQQRSPVSEMAYLKLHSLLQTVLCLSWEEVCFLLGQLGAHLWPGGVmid---------vegE--RSETFPHLVPIVRT 1751
gi 657560221 1664 YIQQQHSPVCVMAYVKLHSLLQTVLCLSWEEVCFLLGQLGAPLWPGGVmdg---------tncA--HPETFSQLVPIVRT 1732
gi 941793263 1698 YIHQQNSQVCEMAYLKLHSLLQTVLCLSWEEVCFLLGKLGAPLWPEGLted---------snvS--CSETFSQLVPIMRT 1766
gi 765145173 1695 YIQQQHSQVCEMACLKLHSLLQTVLCLSWDEVCFLLGELGAPLWPGGVind---------tncS--QSETFSQLVPIVRT 1763
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 984106967 1628 LLDRAYEPLGLQWGLPSLPPTNGSPTFFEDFQAFCATPEWRHFIDKQVQPIMSQFEMDTYAKSHDLMSGFWNACYDTLMS 1707
gi 573896133 1687 LLDQHADPSALHALLPSLPPTNGSATFTQDLQQYICTQEWKDFSTHHVQPTMQQYELDTFGKSHDLMSNFWNSCYDALMS 1766
gi 260807311 1564 LLDKCYEELGMKQYLPNLPARENSPSFFEDFQQYSQSKEWRGFIGKQVLPRMQQYEVDHYGAFGAKMFHFWKACHDGMMM 1643
gi 699246083 1574 LLDKNFERLTMGPYLSELPPTTGSHRFFDDFLEYCQSNEWTTFISACVEPNSSEYITQQYSELSTSMKIFWERAMEQCNV 1653
gi 405951241 1685 LLDKARSLLNLDLLLPDLPPTSNSPVFFDDFKSYCLSEQWKKFIESYVKPQMLHFDESTFGDLESNIRDFWGQCKEAMMV 1764
gi 699603957  249 LMDQCYETLQLQLFLPSLPPTNGSPTFYEDFQLFCTTAEWRGFIEKHVQPTMAQFEMDTFAKSHDHMSNFWNACYDAMMS 328
gi 768922061 1752 LLDQHADPITLNKLLPNLPITNGSTTFAQDLKAFCRTVEWQGFYQQEVRPTMEQYELDTFGRCHDIMSNFWNSCFDDLMS 1831
gi 657560221 1733 LLDQHADPVTLQGLLPNLPITNGSTTFAQDLKAYCHTVEWQSFYQHQVQPTMEQYELDTFGRSHDIMSNFWNSCFDDLMS 1812
gi 941793263 1767 LLAQHADPITLQDHLPNLPITNGSTTFAEDLNVYCKALEWQSFYQQKVQPTMEQYELDTFGRSHDIMSNFWNSCFDDLMS 1846
gi 765145173 1764 LLDQHADPIMLQKLLPNLPITNGSTTFAQDLKAYCHTLEWQSFYQQQIQPTKEQYELDTFGRSHDIMSNFWNSSFDDLMS 1843
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 984106967 1708 NGQRRQRERTHSRRAFQDLVLEPVQRRARLEGLRYVAMLKQQAAQHSTALLHWGALWRQLSSPCGAWALRNPPPPHWKLS 1787
gi 573896133 1767 TAQRRDKDRAHSKARFQEVIVEPCLRRVRSENTRYYSALKQAASQQAAVLRQWKALRRQLTSERGAWALRIQPEVHWKLS 1846
gi 260807311 1644 NIHNRDREKGESKLRFERQIVDVYNKKAADEHARYRVVLKRLRNQHSAALAQWRANKRFFTGERGPWTDRNPNTMHWKLC 1723
gi 699246083 1654 DHHTRWRERGEMRLRFKAQFESDFFAQRESEEDRQSKNSKSLYNQMVAVLRQWRAAKRFLASERGLWRERNPGPTYWKLS 1733
gi 405951241 1765 GMHMKNREKGESKLKFQNKILDPFHNKESSEQKRFHNVTVQLKNQHQSTLRQWRATKRFFTGERGAWSEHSTATIHWKLS 1844
gi 699603957  329 SSQRREQEKAASRKMFQELVLEPAAKRSKAENARHANVLKQANNHHSTVLKQWRSLCRLLTSPRSAWADRNPPEVRWKLS 408
gi 768922061 1832 TAFRRDKDRSDSKSKFQEVVLDPYLRRVKIENSRYLSWQKQISSQQGVVWRHWKALCRLLTSERGAWANRVQSEVNWKLS 1911
gi 657560221 1813 TAFKREKDRSDSKSKFQEVIVDPYLKRVRTENNRYTVWQKQNSSQQVVVWQHWRALRRLLTSERGAWANRVQPEVKWKLS 1892
gi 941793263 1847 TAFKREKDRSDSKSKFQEVIIDPCMKRVRSENNRYVIWQKQNASQQGVVWQHWRALRRLFTCERGPWANRVQPEVKWKLS 1926
gi 765145173 1844 TAFRREKDRSESKSKFQEMIVDPYLKRLRSETNRHLAWQKQNSSQQMVVLQHWRSLRRHFTNERGAWANRVQPEVKWKLS 1923
                         250       260       270
                  ....*....|....*....|....*....|.
gi 984106967 1788 SAETYSRMRLKLVPNHHFDPHLEASALRDNL 1818
gi 573896133 1847 SAETYSKMRLKLVPTYNFDSHREASALRDNM 1877
gi 260807311 1724 PLENFSRMRPKLMPNYNFDCHTEASMLRDNQ 1754
gi 699246083 1734 NNENFSRMRLKLTENYNFDPHEAASRLRDNL 1764
gi 405951241 1845 NQENFKRMKVKMIPNINFDPHREASYQRDNL 1875
gi 699603957  409 SAETYSRMRLKLVPNLNFDQHLEASALRDNL 439
gi 768922061 1912 SAETYSKMRLKLVPNYNYDPHSDASAQRDNM 1942
gi 657560221 1893 NAETYSKMRLKLVPNYNYDPHSEASALRDNM 1923
gi 941793263 1927 AAETYSKMRLKLVPNYNYDSHSEASALRDNM 1957
gi 765145173 1924 NAETYSKMRLKLVPNYNYDAHCEASALRDNM 1954
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap