Conserved Protein Domain Family
DUF4804

?
pfam16062: DUF4804 
Domain of unknown function (DUF4804)
This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 238 and 504 amino acids in length.
Statistics
?
PSSM-Id: 318313
View PSSM: pfam16062
Aligned: 18 rows
Threshold Bit Score: 705.217
Threshold Setting Gi: 827562952
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948961   48 NVIKLSAEFPLEFGVNSVKVYRQSPSRL-ARINEEVASAYPLIHERTLGLYLQYLEHKCRWGNAVEKPIYRNLSLCGFVQ 126
gi 121993723 276 KLMALSDKFPVEFPTDTCRVKAQPAGRF-ANIQQQVASAYPVIHERTLLLYISFLEHKLEFGNSREKSVYKGMSLVDFVQ 354
gi 74872706   59 NFKAISEQSPAEFGIDSCRVKAQPEDRS-DRIREQIASAYPVIHERTLLLFISFLEHKLTFGSEQEKAIYKDMTVVDLVQ 137
gi 195043059  53 KFLTASEKFPIEFGTSSCRVKSQPVERR-QMIRKQIASAYPIIHELTLLLYMNFLEHKQKYGTAQELSVFGNISITEFVQ 131
gi 195457365  41 KFKEVSQNFPIKFGIDTCRVKSQPASRY-EVIQEQIASAYPVIHERTLLLYLNFLEHKKKFGNSKELPIYKDLSLTDFVQ 119
gi 642926646  42 QIIEKSSQFPIEFPLESVRCCQLQNHTAvKTLEKNINSAYPVIHEHALYLCAVFLLHQGKYGEKKE--FYKEMSLLQFID 119
gi 91087253   34 TVLEKSDNFVLKFPVDSNRCKTLRTNVDnDTLERNINSAYPVLHANILQFYAQFILHKRKNGNTIEKALYNDMNLLQFVD 113
gi 194768154  58 KFKGVSENFPHKFPIDSCRVKSQPAARE-DAIRKQIASSYPVIHESTLQLYIKFLKHKLKFGSKTERQLYKNMTLTAFVQ 136
gi 968038723  65 AFMSISDRFPIPFGTDAGRVKSQPVERR-PHIRQQIASAYPIIHEQVLFLYMNFLEHKLKFGNPKELSVYKNLTLPEFVQ 143
gi 827562952  26 DIINRSKNFSIPFPIESVRLDKLKKHRPiDRLKRNISGTYPIIHERILMLMTHFLLYKREFGSSIEKAFYKDMTIPELID 105
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948961  127 RLLVKRCASFFARNDKYLLVSGESGASGFEAVGTREEKAPLVLANVLSYDDIKLSALLSVSSRTEFVNEGERTNCGHVDL 206
gi 121993723 355 RLLSKRCVWFFGGGDYYRLLDGSVGFEGFESVGSATEVPPLLLADVLSYDEIKLSALLYVSTHSEFINNGRRSNAGEVTQ 434
gi 74872706  138 RLLAKRCVWFFGANDYYRTMQGNIGNEGFEAVGTPAEKEPLTLTSVLSYDEIKLSALLYVSCHSEFINNGSRVNGGEVLQ 217
gi 195043059 132 RLLSKRCVYFFDASDSYLLLDGSRGHGGFEQIGSSSERAPLLLRNVLSYDEIKLSALLYVSTHSEFINDGSRFNNGRVEE 211
gi 195457365 120 RLLSKRCVYFFGGGDSYLLLDGQKGHGGIEQIGTEDQKPPLILQNVLSYDEIKLAALLYASTHSEFINNGSRSNAGIVQP 199
gi 642926646 120 RLLNKRAVVFMGPVDHYLLLNKTSGSGRWETIGTSSETPPLVLENCLSYDEIKLSALLSVSSFSYFINNGDRNNMGYFEE 199
gi 91087253  114 RLLSKRAATFIGKQDSYTLLNGKKGRGKWETIGTLAEKKPLVLKDCLSYEEVKLSAFLSVSSFTHFVNLGDRKNMAKYET 193
gi 194768154 137 RLVAKRCVWFYGDSDDHCTMEGQQGIGGFEKVGTGEELPGLTLNSVLSYDEIKLAALLYFTTHSEFINNGSKGNAGMVPL 216
gi 968038723 144 RLLEKRCVYFVGMLDDFMLLDGTHGYGGFEQTGTMNESAPLELKNVLSYDEIKLSALLYASTHSEFINDGSRTNAGRVEQ 223
gi 827562952 106 RLLLKRAVSFMGELDSYLLLSGESGEDGWENVGTLQQRPPLLLENVLSYDEMKLSAFLFVSGPTECINDGSRHNSGVVKD 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948961  207 NTktLERHGVIVGMIGARLSRRNLMEFQDIVIARQQNTRERGYGMAl-----DEPATT--------------RDEDYRRL 267
gi 121993723 435 DKstIEREGVIVGLIGARFERPNVMEYQDIIISPTQNIEANGYGFD------SSENAT--------------RASDYRRL 494
gi 74872706  218 NKdtIEREGVVIGLIGARFERPDVMEYQDIMITKTQNTEANGYGFDleqissETVT----------------PASDLRRI 281
gi 195043059 212 SKskIEIEGVIMGLIGARFERSNVMEWEDIMITPEQNKASRGYGAS------DNESKG--------------RLQDYRRI 271
gi 195457365 200 DKstIETEGVIIGMIGARFERDAVMDCEDVLITPTQNTAAHGYGSM------ENGT----------------RATDYRLL 257
gi 642926646 200 NRsrVEENGVIIGVIGPRLEKSRVMEYREVVICKEQNTSCYGYGPS------EEPT--------------------LQQE 253
gi 91087253  194 DRsgIQDEGIIMGIIGPRLVKNEVMEYQELVITESQNTKTKGYGQT------ETPT--------------------IHHL 247
gi 194768154 217 DKstIEPEGVIVGIIGARFERPNVMEFQDIKITKDQNTLARGYG--------DQNATT--------------GQADLRRI 274
gi 968038723 224 DKsrIETNGIIMGLIGSRFGRSNVMECEDILITREQNTANRGYGYS------GSAE-N--------------RVQDYRRL 282
gi 827562952 186 DD--IEQEAIIIGAIGPRFERTNRMDYEDIVISSTQNSEERGYGEH------VTPTTClhvlrhtytrdaslAKHAWRQL 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948961  268 WREFY-A---TRDLIHGQ-----AV---IDNQRFGPSKNKmDVFDNLVMKRRYAISFDMLLLEAEARAkrVKKLAYIHVV 335
gi 121993723 495 WRGFYeE---PRDFKYTE-----AA---VDGQRFSCAGPGdLIFDNLIMKKRYAISFDTLLLEAQARGvaAGKPAYIHVV 563
gi 74872706  282 WREFYeE---PRDFIYAD-----TP---YDTTRFEEVSQG--IFDHQVMRKRYAISFDTLLLEAQDRAfkAGKPAYIHVV 348
gi 195043059 272 WRDFYmE---PMDFCFDDd---vVA---SDNKRFINLGRN-TYFDKVVMGKRFAISFDTLLVEAEARAvkAGKPAYVHVV 341
gi 195457365 258 WRNFYgE---PKDFVNDQ-----VI---VDGKRFIQLARY-EKFDAVVMHKRYAITFDTLLLEAQARAkkADKPAYIHLV 325
gi 642926646 254 FLKFYgSvngTYDKVLEQ-----IG---SHPEQYLELGRG-KYFDRLMYEKRLALSIDTLLIEANDRAkqENKMAYVHVV 324
gi 91087253  248 FAKLYhE-----QCLECKeilekKK---TNPNRYTTLRND-ELLDNVLYHKRLVFTMDTLFTEANQRAleKNTTAYIHVV 318
gi 194768154 275 WREFYgE---PKDFIFDH-----FQghlAEPQRFESVNGG--YFDHQVMRKRYRNTFETLLLEAQDRAvrAGKLAYVHVV 344
gi 968038723 283 WRQFYeE---PKDFRYND-----VQ---ADGKRFIQLKHD-IKFDKQVMGKRFAISFDTLLLEAEARAasAGKPAYIHVV 350
gi 827562952 258 WAELY-Q---VHSYTYEEl---sARlagAASDRYVKLPRGgAWFDNEVYYKRICILAETVLLEAEGRA--RGRSVFLNVV 328
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948961  336 GFGLGVWKAAEQQERIFMETFEQRMRTLGNR--LNNVGLVHFSWFS--------------ITHCGGLSNGSLIeipghPK 399
gi 121993723 564 GIGLGVWKVTEKQEELFFEAFEERLLALGKR--LTHIGVVHFSWFH--------------LERVRSLHDGATM-----PQ 622
gi 74872706  349 GIGLGVWKAARQQERTFLESFEGRLRALGER--LSHIGVVHFSWFH--------------LACVGSLHDGAIIpvdkhPQ 412
gi 195043059 342 GIGLGVWKAAPQQEEIFLETFEQRLRALSER--LTHIGVVHFSWFH--------------LDKWGGLYDGASIaepkhPL 405
gi 195457365 326 GYGLGVWKISDEQERIFFEAFEERLLALIEMdlLSHIGVVHFSWFH--------------LKKVGGLYNGAVIpqk--sh 389
gi 642926646 325 GLGLGVWKITHQQNKIFMDTFAQRLELLGDE--LKHISDVRFAYIH--------------ETSAGKYSNGDKI------- 381
gi 91087253  319 GIGLGVWKKHPCQNKLFMDSCGQRILNLGKQ--LHNVSDICFAYIQ--------------HNACLSYKHGDVIpieghPL 382
gi 194768154 345 PIGLGVWKAANHQELTFFEAFQESLDGLGER--LHHVGVVHFSWFH--------------LDRVGSLYDGALLrfpqhPQ 408
gi 968038723 351 GIGLGVWKVSDQQEEIFLATFEQRLRALSAK--LTHIGVVHFSWFH--------------LDKWGGLFDGACIeepahPQ 414
gi 827562952 329 GCGLGVWKISPHQTDVYVLTFLERIRAMLDEeaLDHITDVNFAYIRasdnvtalftktneIENSTSTVKSLFVankkhPK 408
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74948961  400 DGIRVLISKRNPARKLSdpehAGMLLVVSYAWDGNALPGNEFWMKMLQSTGDSSTACSTLVAELHNPYINTKfCNGGNLH 479
gi 121993723 623 TGIRIRISARNPADKLD----EDMLPVVTYAWDGNALPGNEFWAGNLVGTGDPAAACSTLISELQNPHINADyMSGHNLH 698
gi 74872706  413 GGIRIRNSVRNPGDKLT----EDMLPVVTYAWDGNALPGNEFWANMLISTGDPAAACSTLISELQNPHINVHyMNGANLH 488
gi 195043059 406 GGIKVRIAVRNPADKLA----ENMLPIVTYAWDGNALPGNEFWAKSLSGSGDPAAACSTLISELQNAHINKDyMCGNNLH 481
gi 195457365 390 SGIKIFISVRNPGDKLM----ENMLPVVTYAWDGNALPGNEFWANMLVGTGDPAAACSTLISELQNPHINLKyMSGSNLH 465
gi 642926646 382 KGITLHMIDKNPQEKLAgd-dEGKLLVVSYPWDGNALPGNEFWMGSLNRSGDTAAASSSQVAELHNWHINAK-ASARNLR 459
gi 91087253  383 KGIRVHICKREPHAKLTgr-dEGKLLVVSYAWDGNALPGNEFWIGKLGSSGDSAAASSTQITELHNPFINPN-VSSGNLR 460
gi 194768154 409 GGIKIKISNREAHSKLP----EDMLLVVTYAWDGNALPGNEFWDGVLVSTSDPAAACSTLITELQNPHINREyMNASNLH 484
gi 968038723 415 GGIQVRISVRNPADKLK----EPMLPIVTYAWDGNALPGNEFWSKSLDSSSDPAAACSTLIAELLNAHINKDyMSGNNLH 490
gi 827562952 409 GGVSVQLEDREPASRLHgr-hRGKLLVLIYPWDGNAHPGNEFWLGSLTGSGDPAAACSTQVAELHNAHVNPR-VAAANTR 486
                        490
                 ....*....|....*.
gi 74948961  480 IASPEhGVLHIAEYAK 495
gi 121993723 699 IASVEhGLLHIGEYAR 714
gi 74872706  489 IASVEhGLLHVGDYAR 504
gi 195043059 482 IATLEhGVLHIADYAE 497
gi 195457365 466 IASLRhGLLHIGEFAQ 481
gi 642926646 460 IATFK-GLYTFKEYQE 474
gi 91087253  461 VVKDG-KVVGLEEYAA 475
gi 194768154 485 IASLEhGLVHVGDYAR 500
gi 968038723 491 IASMQhGVLHISDYAE 506
gi 827562952 487 VAAHA-AVLPLRDCAE 501
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap