Conserved Protein Domain Family
DUF4828

?
pfam16110: DUF4828 
Domain of unknown function (DUF4828)
This family consists of uncharacterized proteins around 120 residues in length and is mainly found in various Enterococcus and Lactobacillus species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318357
View PSSM: pfam16110
Aligned: 17 rows
Threshold Bit Score: 98.4411
Threshold Setting Gi: 498432453
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 122266153  33 FFAGTWLYHDQTTNREHELDIRPNYDVYLDGKLLKTVVEALDDYGITFIDRFGYHLIIKANDYRPISIYDEANNETYAI 111
gi 81437153   38 NYTGHWWFVDVKKATQHTLEITSSFNVFIDGKQTHALLVELTPKRLVILDKLGYHLIIQCENGVPATLYDEADDETYTL 116
gi 753778965  28 FYAGTWVYQDNSTNRKHQFEIQPNYDVYLDKQLIKTQVESVTPSRLILIDNFGFKIVIRTNGRSPISIFDEANDETYAI 106
gi 514878741  34 NFIGNWRFTS-KTKEDVILEIANDYSLTIEGKPLPVSIVELTPMRLVLLDTFGYHLVLEQKGSV-ITLYDEAEDCHYSL 110
gi 489218410  34 QFVGKWQFTS-KMKDTVSIEITEEHSLTIDGKHSPTVIVELTPSRLVLLDSLGYHLIIEQKDQR-FTLYDEAEDWQYPL 110
gi 497738975  42 hFQGQWRKKDDADTQLIFLSISSEGEFFLNQKELAGKIIHATDQKLVFEDSFGYQLVLELTAPGELTLYDDAEEQDYFL 120
gi 488223330  36 KYQGTWFFSD--SQQKQQLQITSDYTFLINGQSLGTSVVEIDEYRLVVRDQYGFYLIFSYPEQ---TLYDESADTSYKL 109
gi 498432453  37 QYHGTWTFID-KNQQKQQLLVTETFDLSINGHSLVTELVELTPQQLVLRDQYGFYLILSYSDT---TFYDESSDTSYTL 111
gi 504753194  35 FFVGTWQFKD-HRERVHRLEIDPDLKLLIDGKDMSAKVSLLTRYELSYVDKFGYKLEIRGNEARPIKFYDESENYTYDL 112
gi 489764761  38 FYAGTWQYYDKERDRSHKITISPELKLSIDNQIIPATVQQIKPDKLVFLDRFGYHITIQANEQRPISLTDEADDQVYTI 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap