3MWE


Conserved Protein Domain Family
Citrate_bind

?
pfam16114: Citrate_bind 
Click on image for an interactive view with Cn3D
ATP citrate lyase citrate-binding
This is the citrate-binding domain of ATP citrate lyase. This domain has a Rossmann fold.
Statistics
?
PSSM-Id: 318361
View PSSM: pfam16114
Aligned: 44 rows
Threshold Bit Score: 223.638
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MWE_A        247 YPEEAYIADLDAK-SGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILS 325
41_pfamImport   2 SPEEKFVEELDER-TGASLKLTVLNPTGRVWTMVAGGGASVIYADTVADLGFAHELGNYGEYSGAPTQELTYQYANTLLR 80
23_pfamImport   4 YPEETYVNELDEK-TGASLKLTLLNPTGRIWAMVAGGGASVIYADTVADMGYGHELGNYGEYSGDPNEEDTHKYACTIIS 82
13_pfamImport   4 TPAEESIHKMDEK-TGASLKLTILNPKGRIWTMVAGGGASVIYADTVGDLGYAHELGNYAEYSGAPSEEETLHYARALID 82
11_pfamImport   4 SPTKSFIHRLDEKtTSASLKFTVLNPKGRIWTMVAGGGARVIYADTVGDLGYASELGNYAEYSGAPKEDEVLQYTRVVID 83
34_pfamImport   4 SPSESYIHELDEK-TSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGNYAEYSGAPNEEEVLQYARVVLD 82
16_pfamImport   4 TPQEARIHSLDEA-TGASLKLSILNPRGRIWTMVAGGGASVIYADTVADLGYAEELGNYAEYSGGPNTAETYQYARTLLD 82
14_pfamImport   4 TPAEEAVSALDEA-TGASLKFTVLNPAGRVWLMVAGGGASVIYTDTIADLGFAQELGNYGEYSGAPNTSETYQYARTVLD 82
5_pfamImport    4 TEAEQQIMDIDAR-IKGSVKLVEV-PGGNIALLTAGGGASVFYSDAVVARG--GSIANYAEYSGDPPDWAVEALTETICR 79
12_pfamImport   4 SKQELEVMAVDSK-IKGSVKFIEI-PGGDTAMLPAGGGASVYYSDAVVARG--GKLANYAEYSGDPPDWAVEVLTEKVCS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3MWE_A        326 LMTReKHPDG--KILIIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIH 403
41_pfamImport  81 CMLKyPREEG--KILLIGGGIANFTDVADTFTGVIQALQENKDDMIKQKTKIYVRRGGPNYQRGLKLMKECADSTGLDMQ 158
23_pfamImport  83 LATR--NPDSkpRALLIGGGIANFTDVAATFKGIIRAIKEYHQDIIKANLSLFVRRGGPNYQSGLQHMREIGHKLHIPIK 160
13_pfamImport  83 CVT--ANPDGrrRALLIGGGIANFTDVAATFNGIIRALREKESQLKAAKVHIFVRRGGPNYQKGLERMRTLGRDIGIPIE 160
11_pfamImport  84 CAT--ANPDGksRALVIGGGIANFTDVAACYF----QWHNPRSKAESSKDAYICEKRRTKLPKGLAIMRALGDEIGVPIE 157
34_pfamImport  83 CAT--ADPDGrkRALLIGGGIANFTDVASTFSGIIRALREKESKLKAARMNIYVRRGGPNYQTGLAKMRALGSELGLPIE 160
16_pfamImport  83 AAT--AYADGrgRALIVGGGIANFTDVAATFKGIIQAFREKQEAIKAARMKIFVRRGGPNYQAGLEMMRRLGDEIGVQIE 160
14_pfamImport  83 CAT--AHADGrgRVLLIGGGIANFTDVAATFTGIIQALKEKKAALQAAKVRIFVRRGGPNYQKGLALMRSLGDELGVPIG 160
5_pfamImport   80 LPNI--------KHIIVGGAIANFTDVKATFNGIINGFRESKSKGYLENVQIWVRRGGPNENQGLAAMKKLQEE-GFDIH 150
12_pfamImport  80 LPGI--------RNIIVGGAIANFTDVKKTFGGIINGFRKAKSEGKLKNVKIWVRRGGPREKEGLDAMRALKEE-GFDIN 150
                         170
                  ....*....|....*...
3MWE_A        404 VFGTETHMTAIVGMALGH 421
41_pfamImport 159 VFGPETHITAIVSMALLS 176
23_pfamImport 161 VFGPEVNMTSIVAMAIQH 178
13_pfamImport 161 VFGPEASMTGICRNAIDY 178
11_pfamImport 158 VYGPEATMTGICKEAIQY 175
34_pfamImport 161 VYGPEATMTGICKQAIDC 178
16_pfamImport 161 VFGPEASMTGICQLAIDY 178
14_pfamImport 161 VYGPESSMTGICAEAIDY 178
5_pfamImport  151 VYDRSMPMTDIVDLALN- 167
12_pfamImport 151 VFDRNTPLTDIVDKALQA 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap