Conserved Protein Domain Family
DUF4835

?
pfam16119: DUF4835 
Domain of unknown function (DUF4835)
This family consists of uncharacterized proteins of around 300 residues in length and is mainly found in bacteria from the Cytophaga-Flavobacteria-Bacteroides (CFB) group, both environmental and from human microbiome. The function of this family is unknown.
Statistics
?
PSSM-Id: 318366
View PSSM: pfam16119
Aligned: 87 rows
Threshold Bit Score: 337.555
Threshold Setting Gi: 501491862
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122372706   25 ELYMNVTIDASQIPDI---QESVVTDMKQTITRFLNDRKWTNDEFQVEERIRGNISITITGQPAPYSYAATLQVQSSRPV 101
3_pfamImport    2 ELNFTVIINSDRARIQ---NTTVFSTMKTSFEQFLNGRSWTTDEFRPEERIQGNLLITINDVPQVGIYNATVQVQVVRPV 78
53_pfamImport   2 ELNFQVIINSDRARTQ---EKDIFEDMKTTFEQFLNGRNWTNDEFRPIERIKGSMLITINDMPQVGFYNATVQVQVVRPI 78
36_pfamImport   2 QLNFTVTINSERARTQ---DTDIFDQMKSAFEQFLNGRNWTDAELKPQERIKGNLLITINDMPQVGIFNATVQVQTVRPI 78
58_pfamImport   2 ELNFTVTINSDRARTQ---NKDIFDQMKNSFEQFLNGRSWSNDQYDAAERIKGNMLITINDMPQVGYFEATVQIQAVRPV 78
84_pfamImport   2 ELLSEVTVTTENVTIS---DRQLVQDMKNAMQTFLNTRAFTNQVYRPEEKIRCKVFVGITEIPQNGTYKATVRILSTRPV 78
gi 503218463   22 DLFFQIKVDASTANTS---ETRVFTDMENAFKQFMNETKWTDEELELFERIKGVMVINITDIPRTGRYQADMQVQSVRPV 98
gi 503175411   19 ELQCQVRVNFSQLSSNtsgDREIFAELERSISDFMNGQRWTNDIFAPGEKIKCNLNINLLRSSGQYNYSGTAQFQVLRPV 98
gi 502606586   30 ELNCSVLVNYQKLQGS---QYDYLRELEDQIRRYLNERRWTNDAFEDIERIDCTVQIFFEEAVTLTRFRARLVLATRRPI 106
gi 504373452   21 ELNCRVTVNYEKLPIN---NRELLVNFASEIETYMNKTQFTNEPFE-GEKINCALNIFFTSASSDIEYSAQVVVTSTRPV 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122372706  102 YGTSYETILLNYFDKNFNFELN-IGEPLNYNDNMFTSNLTSMLAFYANIILALDYDSFGKLGGQTYVEKAYNIANISLQA 180
3_pfamImport   79 YGTNYETLIFNFADRNWNFDYI-ESQPLEFNRFNFLNNISSLLGYYAHIALGMDYDTFEKEGGQQFFEIANDIVNNAQQS 157
53_pfamImport  79 YGTNYESMTFNFIDRNWNFEFL-QNQPLEFNRFSYLNNISSLLAYYANMALGIDYDSFTLRGGDPYFEIANGIVNNAQQS 157
36_pfamImport  79 YGSNYESLILNFADRNWTFEYT-ESQPLEFNQFSYLNNITSLLAYYAYIAIGIDHDSFSPRGGDPYFEVANNIVANAQQS 157
58_pfamImport  79 YGTSYETLTFNFVDRNWNFEFK-ESQPMEFNRYSYLNEITSLLAYYAYIVIGIDYDTFSPEGGEPYFEIANNIVSNALQS 157
84_pfamImport  79 YGTGYETNVLSFADRGWIFNYS-PQNPIDYSQNTFVGNLSSLLTFYAYIIIGMDQDSFAPLSGSPYYDRARTILVNAASQ 157
gi 503218463   99 YNSNYESIMFNIADRKLSFDYT-ESQPLIYTKNSFNNNLVSILAFYANFLLGMDFDSFSELGGQKYYDEALNIARSAQQQ 177
gi 503175411   99 YGSTYESVIFSFLDRNFDVSFApESRQMIFNEQIFTSNLTSMLAFYSLTALAIDYDSFSRFGGNPFVDRLYNIVTLAGNA 178
gi 502606586  107 YGTTQYTTVLQLSDPNWEFEYP-QGTPLIFNLEQFH-PLTSVLDFYAFVILGYDYDTFSELGGTPFFEQARRIAELAQAA 184
gi 504373452   97 FKSDKQSPMLTINDANWNFKYE-KGQPLYSNQSIYD-PITSFLDFYANIIIGFDYETWGEFYGTEFFQKAFNIANLGMNS 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122372706  181 G------GGWSQSGDA-NNRAALIENLNSQL-LLPFRQNFYNYHRLGLDIYLSDPAKARLQIVGMFKALNEV-IKLKPYS 251
3_pfamImport  158 Gr-----PGWVQSPTDrRNRYWLINDIYSSPvYAPIREANYLYHRQGLDILLTEPEKAYENMLEAVRLVAEA-NKAQPNG 231
53_pfamImport 158 Nr-----PGWNQSPTDrRNRYWLINDIYTSSvFAPIREAIYLYHRKGMDLLNKDPNEAYKNMLEAIKKVEEA-NTAQPNS 231
36_pfamImport 158 Ss-----SGWNQNPSDkRNRYWLANDLYNSQvMVPVRDAYYLYHRMGLDLLTTKPSESYQNIVEAIKMVQEA-NKVQPNS 231
58_pfamImport 158 Sr-----LGWDQDPSNrRNRYWLIDELYSSQvTRAIREAYYLYHRRGLDMLTQNSEKAYENITKALGKLSEV-NNIQPNS 231
84_pfamImport 158 NvtnetdEGWKDTNNG--NRYWLLNNLQDPQ-LEAFRSAIYAYYRQGMDIFITKPEEARAGMATALQGVQQA-VQRRPGT 233
gi 503218463  178 Gf----qPGWEQFGNL-QSKYALVQSALNSQ-LEPVRKSLYLYYRKGLDMMEEDPKEARKSVLEALENIQKA-NKLNPNS 250
gi 503175411  179 Ag-----GAWLSSADI-RDRYWIMENLRNPQ-FAVYRERFYEYHRLGLDILTEKPAEGRKIMMEFIETVKTL-NELRPSA 250
gi 502606586  185 Ga-----NGWNQIGDD-RSRVALITQLLDPR-YRAVRQAYFKYHFEGLDHFVQDPEAARAAVLDVLRSLEAL-YQEVSRP 256
gi 504373452  175 Ny----kKGWERTSDA-YNRTRLCEDLLNDK-FRPFREAFYEYHY-GLDLYQVNKEEAQEHIANLVNVLNDMkNKTDINS 247
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*...
gi 122372706  252 TLIRSFFLAKRDEIINIFRDA-DTEQKNEVVNLLRVLDPLNSERYATI 298
3_pfamImport  232 ILTITFMDAKGDEISKVFKGA-SLEIRTELVELLLEVDPNNARKYNEL 278
53_pfamImport 232 IFTISFMDAKGDEISKIFKNA-PLEIRTEAVELLLKVDPNNARKYNDL 278
36_pfamImport 232 ILTISFMDAKSDEISKILKAA-PMELKEEAVEVLLKVDPNNARKYNDI 278
58_pfamImport 232 ILTISFMDAKSDEIAKVLKNA-PEDLKAQAVEYLLQVDPNNARKYNAI 278
84_pfamImport 234 LLARAFFTTKAAEISDVFRTSpSQEQKTQVTTLLTEMDPTNSAKYQTI 281
gi 503218463  251 PFITVILQTKSEEIVQIFTEG-DMTIRRKAYEIMRDIAPANSQDYEvm 297
gi 503175411  251 TLLTLLMDAKGEEFTGVFSEA-SKKEKEAVYKICTTVSPDKTEIMRSL 297
gi 502606586  257 YVMDLFFTAKYQELAAIFEGS-RLA--QEAFSILSELDPSHLSEYNRL 301
gi 504373452  248 VLLRTFFDAKNGEITDLLRDY----RDINIFNRLKRIDPAHISKYNEv 291
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap