Conserved Protein Domain Family
DUF4841

?
pfam16129: DUF4841 
Domain of unknown function (DUF4841)
this domain is found on the N-terminal of several uncharacterize proteins found in various Bacteroides species. Solved structure of one of them (BACOVA_00967) from Bacteroides ovatus shows a small beta barrel with an immunoglobulin-like fold. DUF4841 domain shows weak overlap with the DUF4114 family, suggesting a possible distant relation. Function of this domain is unknown.
Statistics
?
PSSM-Id: 318376
View PSSM: pfam16129
Aligned: 7 rows
Threshold Bit Score: 89.4706
Threshold Setting Gi: 319417912
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 81314318   64 TRVAIYTDAACTDESLLAETPV--SDISKSIELDVAKANRALYVQYPAGKG-KEVISVPIN 121
gi 524515768  67 TIVSFFLDEACSEEEKLATIPV--YAETSSLPLSIPTYAKTLYAQYKNGSGaMIKATMPIN 125
gi 524133014  63 TVASIFTDESCNEDQLIAQVPV--SATPNEIMLEYPASTQTLYLQFPLQNGkKEVMPVVVK 121
gi 524514415  59 TLISLYSDAEC--KIPLLENAL--VEGETTVDLNIPMHSQTVYAKYAAMSG-PQVRTINLK 114
gi 319417912  47 TFASIYTDAACSADSLIMENIAlnANEAKEISLELPTYITSVYVQYPTANG-TGTSEVNVG 106
gi 262352792  65 TMVSFFLDEACSKEEKIADIPV--DTEISSLPLSIPTYVNTLYAQYKTSTNeTKKVAIPVN 123
gi 524325696  43 ALVSVYADKNDLEASPLAGDVL--VDGSRTLTLNVPAACEKVYMKYNTVSGtEAIKEFALS 101
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap