Conserved Protein Domain Family
DUF4864

?
pfam16156: DUF4864 
Domain of unknown function (DUF4864)
This family consists of uncharacterized proteins around 120 residues in length and is mainly found in various Anabaena and Nostoc species. Distant homology analysis suggests this family is related to NTF2-like proteins and specifically to proteins that bind small molecules. HMM partly overlaps with Tol_Tol_Ttg2 (PF05494) involved in Toluene tolerance and lumazine binding family (PF12870) and these families should form a clan.
Statistics
?
PSSM-Id: 318401
View PSSM: pfam16156
Aligned: 20 rows
Threshold Bit Score: 108.92
Threshold Setting Gi: 81626424
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122378589  25 MRDVIDSQLSAFQQDDFAQA-MEYASPGLQRYFATPENFRRMVTQGYPMVWRPDTVEYLENRTEDGIH-WQRVRIKDMEG 102
gi 123285987  39 IEAVIGNQFDAFREGALLDA-WQYASPNIQGQFGDVQNFGRMVEQAFPMVWQPGEVDFIDLQTFGAIV-VQRVEVVDQAG 116
gi 122984171  29 ITGVIGAQIEAFQANDMGTA-FGFASPNIRALFGTPERFATMVEQGYPMVWRPADVRYLELREVAGNL-WQRVMVTDADG 106
gi 81350718   25 IKAVIGNQIEAFLADDFATA-FTFASPMIREIFRTPENFGSMVRNGYPMVWRPAEIRYLGLEEREGTL-WQLVRVTDRQG 102
gi 81710734   45 LEAVIQSQLAAFRKGDYAKA-YTFASQGIRRRI-PAAVFAEMVRSAYPAIARSRSARFGPILDDGDQA-VVHVVVEGAEE 121
gi 81626424   75 V-DVIDKQLEALRNNEISKAyYEYTSKEFQAAT-SLDQYRQFVET-YPAFLNNHSAHFTQRAIKNNVS-TLKGNLSTQNH 150
gi 503418309  37 FRRIVQDQMAAFRRNDAAGA-YALATPGLQREFHTPEIFMAMVRQGYMPVYRPKSVSFGRARMTPHGP-VQEVFVVGPDG 114
gi 763149062  24 IEAVIGAQLEAFKADDFAQA-FSYASPMIQTMFGTWQRFGSMVRNGYPMVWRPAEVRFLELEDRGGSL-YQRVRIRDAQG 101
gi 502095442  27 aRSVIRAQIKAFLDDDPETA-YSFASPGIREKFPDQLVFFEMVKKSYQHLYRPGNFAFGRSKLVGNEV-IQEVLIFGSDG 104
gi 501275551  27 ARAVIAKQAQALGRDDAQTA-YEQAAPGIRELFPNADLFIGMVRNQYRPVYRHRSFVFGEARDTDAAGvVQSVAIQDEYG 105
                         90       100
                 ....*....|....*....|...
gi 122378589 103 KVHILDYRMLETENG-WRINGVQ 124
gi 123285987 117 NLHYLGYAMVETDAG-WRINGVQ 138
gi 122984171 107 DIHMLDYQMIETEAG-WKINAVQ 128
gi 81350718  103 LAHVLAYQMVNLESG-WKINAVQ 124
gi 81710734  122 QA-TYAYQMIREGRV-WKVNSVT 142
gi 81626424  151 TNIPVEYRLIKEDDK-WKILSIR 172
gi 503418309 115 EAWLALYSFARQDDGvWRISGCI 137
gi 763149062 102 GSHLLEYQMIRNQAG-WRINGVQ 123
gi 502095442 105 KDWTAIYELVPQPDGsYKINGVv 127
gi 501275551 106 VDWTAEYSLARDADGqWRITGCR 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap