Conserved Protein Domain Family
Kinesin_assoc

?
pfam16183: Kinesin_assoc 
Kinesin-associated
Statistics
?
PSSM-Id: 318424
View PSSM: pfam16183
Aligned: 8 rows
Threshold Bit Score: 238.613
Threshold Setting Gi: 511003972
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47228264    353 AVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIENlcdykn-----------------fvnnrqAANqrGDLSTVTNA 415
gi 542259751   353 AVINEDPNAKLIRELKAEVERLRNLLFSQGLQELLDNa----------------------------VNN--NNNINGPGG 402
gi 972956571   353 AVINEDPNARLIRELKEEVNRLRELLFSQGLSTELITa----------------------------AGTeaNNNRLMPVG 404
gi 511003972   355 AVVNEDPNAKVMRELKDEVDALRQALMVYAPEEVEKIqaiah-------------------ptkkrASTpaASAAAAPAA 415
gi 803128021   358 AVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDidpliddysgsggkylkdfqnnkhryllasENQrpGNFS--TAS 435
gi 677972633   322 AVINEDPNNKLIRELKDEVARLRDLLYAQGLGDIIDnvsdfenn---------------ndargaeLSHrhDNLSTVTNA 386
gi 1040286638  296 AIINEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDsecpchsdldman-----lenrnhncggaeLSQapNNLSTVTNA 370
gi 992198654   358 AVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEnlsnykt-----------------nvtsvqAVSqrDHLSTVTNA 420
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47228264    416 MTGMSPS---P-SLSALSS-------------------------------RAG--SISNLHDRVfs-pAS--------EE 449
gi 542259751   403 VAGASPS---P-LQLALTSngitpengsappgaepvsegdtpadpdqlieDGEerEEGESTENI----SK--------EE 466
gi 972956571   405 VSGAPFN---S-SEVIDDSlchaqeqglds----------dpptgdlsadNGHseTFSGIDEPI----TK--------EE 458
gi 511003972   416 GAIARPKslsPpSLPANSK------------------------------------------STVvftdASgnttqltkEE 453
gi 803128021   436 MGSLTSS---P-SSCSLNS-------------------------------QVGltSVTSIQERImstpGG--------EE 472
gi 677972633   387 IAGISPS---S-SLSALSS-------------------------------RAA--SVASLHERImfapGS--------EE 421
gi 1040286638  371 LVGMSPS---S-SLSALSS-------------------------------RAA--SVSSLHERIlfapGS--------EE 405
gi 992198654   421 MTGMSPSpslS-ALSALSS-------------------------------RAG--SISSLHDRImfspGS--------EE 458
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 47228264    450 AIERLKETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVALREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIK 529
gi 542259751   467 AAERLMETEKIIAELNETWEEKLRKTESIRLERESLLAEMGVSIKEDGGTLGVFSPKGTPHLVNLNEDPLMSECLLYYIK 546
gi 972956571   459 AVERLKETEKIIAELNETWEEKLRKTESIRLERESLLAEMGVSIREDGGTLGVFSPKGTPHLVNLNEDPLMSECLLYYIK 538
gi 511003972   454 MVEQLQMTEKLLGELNQTWEEKLHNTEKIHVDREKSLKHLGITIEKN--NVGLYTPKEVPYLINLNEDPLMSECLMYNIK 531
gi 803128021   473 AIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIK 552
gi 677972633   422 AIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIK 501
gi 1040286638  406 AIERLKETEKIIAELNETWEEKLXRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIK 485
gi 992198654   459 AIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIK 538

                   ...
gi 47228264    530 DGI 532
gi 542259751   547 EGV 549
gi 972956571   539 EGV 541
gi 511003972   532 PGI 534
gi 803128021   553 DGI 555
gi 677972633   502 DGI 504
gi 1040286638  486 DGI 488
gi 992198654   539 DGI 541
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap