Conserved Protein Domain Family
BLM_N

?
pfam16202: BLM_N 
N-terminal region of Bloom syndrome protein
BLM_N is the very N-terminal region of chordate Bloom syndrome proteins. The exact function is not known.
Statistics
?
PSSM-Id: 318442
View PSSM: pfam16202
Aligned: 19 rows
Threshold Bit Score: 318.257
Threshold Setting Gi: 847108045
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921178      1 MAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTSEG-DVSVTSVSVVK-TPALSDKDVNVSEAFSFTESP-L 77
gi 148675035    4 MAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTSEG-DVSVTSVSVVK-TPALSDKDVNVSEAFSFTESP-L 80
gi 821452801    1 MAIIPQNNLQQQLERHSAKEIQNKLNVLKHKSTGFTFKKKIPS-------SSSVTQ-AFVLSDKDVNITENVPLSKPL-P 71
gi 611967735    1 MAVIPQNNLQQQLERHSAKEIQNKLNVLRPKSTGFTFKKKIPPGn-------SVTH-APVLGDKDVNVTETFPLSKAF-F 71
gi 620962800    1 MAALPQNNLQQQLERYSAKETHNKLSLQKPKSTGFTFKKNLSPGsSVSAACLKVPNtTAALRDKDVNSTTASSLG----- 75
gi 655884813    1 MAAVPQNNLQEQLELHSARKLHNRLNLSKPKSSGFTFKKKASSGnSASVTSVSAAR-TPVLSDKDVNVTEGSSFSEPQ-A 78
gi 556989705    1 MTAVPQNNLQKQLELHSAKGAQNKLSLSKSKPGGFTFKKKTPPGnNDATTFSEVKL-TNVLKDKDVNIHENISLAKPLtS 79
gi 564329135   10 MAAVPLNNLQEQLQRHSARKLKNQFSISKPKPSGFTFKKKTPEGd------VSVVR-TPVLSDKDVNMSEALSYTEPP-L 81
gi 537205252    6 MAAVPLNNLQEQLQRHSARKLNNKFDLSKPKSSGFTFKKKTSEG-DVSVTSVPVVK-TPALSDKDVIVSEAFPSTESPlL 83
gi 512981741    1 MAAIPLNNLQEQLERHSARKLNNKSDLSKPKPCGFTFKKKTTSDnDASVTSVSIAK-TPVLSDKDVNVSEVFSFTEPP-P 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921178     78 HKPK---QQAKIEGFFKHFPGRQQ--SKGTCSEPSL---PATVQTAQDTLCTTP--------KTPTAKK-LPVAVFKKLE 140
gi 148675035   81 HKPK---QQAKIEGFFKHFPGRQQ--SKGTCSEPSL---PATVQTAQDTLCTTP--------KTPTAKK-PPVAVFKKLE 143
gi 821452801   72 NTKN---QQASITASSEKTSKGQQ--IHKFCSNQIL---SDSSKNTHETSCYLQps-----tNENSVKK-VLCKDSKKLE 137
gi 611967735   72 NAKN---QQTSISDSSEKTSKAQQ--IQKFCSNQIL---LNSSKNTQETSKVSQpp-----tKENCVKK-ELCKDSKILE 137
gi 620962800   76 --GN---QQRRIGGFFEKSLKNEE--TQPLGTDRAG---SSSRKTQTAVSRGSQpp-----aKGMTITPdPPDIVSKRLD 140
gi 655884813   79 CPAG---PPARINDFFKNAPAGLQ--SRGAGSTPLL---PDVSQTPQEASCTPR--------LAPAAKt-pRDTVFKKLD 141
gi 556989705   80 SLTKhndQQLKIGHFFEKNCKSQPqvTQMFSGQPFLncsESVRQTSKILPVFTRpeetikepKQPSAK---PEESSKKSE 156
gi 564329135   82 HKPK---QQSNIDGFFKNSPGGQQ--SKETCSELSL---PEVVQIPQDASCTTP--------KTPAVKk-pHVAIFKKLE 144
gi 537205252   84 HTPK---QQPGIDGFFKNSLGEQQ--TK--GTKPSQ---LDLVQIPQEVLCTAP--------KTPAVKk-pHISVFKKLE 144
gi 512981741   79 HTPS---QQPRINGFFKNAAVGQQ--GQRTGSKLLL---TGLLQIPQEALPTTQ--------NISAVKk-pHNAILKKLE 141
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921178    141 FSSSADS---LSDWADMDDFDMSA-----------------S--DAFASLAKNPATRVSTAQK------MKKTKRNFFKP 192
gi 148675035  144 FSSSADS---LSDWADMDDFDMSA-----------------S--DAFASLAKNPATRVSTAQK------MKKTKRNFFKP 195
gi 821452801  138 LNSSFDStslVSDWDDIDDFDTSGn----------------S--KTFTTPSRSNFAKLNSTQR------SKGDKNNLSKT 193
gi 611967735  138 TNSSFDSi-lVNDWDDIDDFDTSGn----------------S--KTFTTPSRTHFTKLNNTQR------SKTDKNNLSKT 192
gi 620962800  141 FSSALDTilsLDDWDDLDDFDTSGk----------------NcpKAFVTPPSSQAVKAGRTPV------SSR-KDDASNA 197
gi 655884813  142 FSSSLDSlgaLNGWDDMDDFDTSGt----------------P--KAFAASPRKPVARVSTAQK------SKRAKRNFCKA 197
gi 556989705  157 LDCSFSTvisIEDWDDLDDFDTSWkdkkssqtisppdkvrqA--KHYKSTPSSHQSKINLSSGtfndslSTRNSKNVLSP 234
gi 564329135  145 FSSSADS---LSDWADIDDFDVPA-----------------S--DAFVSLTRNPTTRVSTAKK------LSSSKRNFFKP 196
gi 537205252  145 FSSSPDS---LNDWADMDDFDISA-----------------S--DAFVSMSRNPVIRVSTAQK------PKKSIRNFFKP 196
gi 512981741  142 FSSSSDSfhtMNDWDDMDDFDTSEt----------------S--KVFATPPKNHLVRVSTAQK------SKKAKRNFFKA 197
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921178    193 PPRKANAVKTD---LTPPSPECLQVDLTK----------ESEeeeeeeeeaEGADC---L-------------------- 236
gi 148675035  196 PPRKANAVKTD---LTPPSPECLQVDLTKeseeeeeeeeEEA---------EGADC---L-------------------- 240
gi 821452801  194 RARKANGKKVDpelLNFPSGKNKQAELIK----------KEL---------PESEE---L-------------------- 231
gi 611967735  193 Q---TSGKKIDpelLNFPSGKSRQVELTR----------KEL---------PESEE---L-------------------- 227
gi 620962800  198 RVSKAKTGKVGvelVEPRPGGGDRVARTS----------DPL---------REPE----P-------------------- 234
gi 655884813  198 QLKKADAAEAD---LTPASAASKPVELAGagk-------------------gdCDG---V-------------------- 232
gi 556989705  235 QKSIQDTMDKDnqvGYANSFEISERSLTC------------------------VDLvslNstgkdcndaaevpaakkksl 290
gi 564329135  197 PP-RASAVKAD---LTPSSPECLQVDLTKeqe-------------------eeADC---L-------------------- 230
gi 537205252  197 PPHKASVVKAG---LTLSSPESSQVDLTKdqk-------------------deSEY---L-------------------- 231
gi 512981741  198 QPHKTNTVKAD---LTPS--ESQPVDLTKeek-------------------ddSEW---L-------------------- 230
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921178    237 SRDVICIDNDSAS--EELTEKDTQESQSLKAHLGAER-----GDSEKKSHE---------------DEAVFHSVQNTE-- 292
gi 148675035  241 SRDVICIDNDSAS--EELTEKDTQESQSLKAHLGAER-----GDSEKKSHE---------------DEAVFHSVQNTE-- 296
gi 821452801  232 SSPMICLDDDPIS--EEFKNEDIQEKQALKTQLDDER-----DYSEKKKSP---------------ERVEQHTIDESLga 289
gi 611967735  228 NSPVICLDDYV-S--EEVRNEDIQESHASKTHLCKER-----DDNEKKKYP---------------NGTEQHAADESLga 284
gi 620962800  235 SGDSVIYADTADS--RGIPAEDVQEVRSFEAISHDEReknhtDDREKEQNSeeiefpegeedcchvQESDSGWDEKPL-- 310
gi 655884813  233 GGGVICIDDDdgpvsqvlI-LDSQESHSLETHLGGER-----DHPEDKKVL---------------DTVELHSAEEVP-- 289
gi 556989705  291 STGSVVIDEE--------ETNCIKENERRD----SET-----QNRELKWRE---------------TDGDSNLVHQSNe- 337
gi 564329135  231 SRDVICIDTDpas--eelLEKDVQEGLSLDARLGTER-----VDSAKKSHE---------------DKAAFQSPQNAL-- 286
gi 537205252  232 SGDVICIDSDpgs--eelVKKDAQESQSLETELEVER-----DNSEKKNHV---------------GEVKLQSTEKAL-- 287
gi 512981741  231 KSGVICIDDDsip--qvhTDEDTQERHSLKIHLGDER-----DNNEKH-NE---------------EDVELLSSEKAT-- 285
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5921178    293 -YFEHNDNDYDIDFVPPSPEE-II--STASSSLKCSSMLKDLDDSDKEKGILSTSEELLSKPEEMTTHKSDAGTSKDCDA 368
gi 148675035  297 -YFEHNDNDYDIDFVPPSPEE-II--STASSSLKCSSMLKDLDDSDKEKGILSTSEELLSKPEEMTTHKSDAGTSKDCDA 372
gi 821452801  290 nCEEFNEDDFDIDFIPPSPEEgVF--S---SSLRYLCTLKEPSICDEGKNATKLSNYFSSESEKTTSPQLLQETSTKYDG 364
gi 611967735  285 dFAEFNEDDFDIDFIPPSPEEeVFspSSCSSSLKYFSTLKESSTCDKEKNGTKLSDDFLSESEKTTSLQPIQETSTKHDG 364
gi 620962800  311 -VGVIEEDDYDVDYVPPSPEEeVLssCSSSASLKRISVLKESAIYSGRRTTPDESN-VLSNPKRTTSEERKIETAMERDD 388
gi 655884813  290 -CIELEDDDYDIDFVPPSPEEeVS--SATSSSLKcsSMLKDLDTPHREKDVLSPAQDLLSKPEKLTPQEPDPETTAGCEA 366
gi 556989705  338 -NFVFENDDFDIDFIPPSPQDpMS--SPSFIQHK--SNLKQSTCCSEGLLGMTISDPVISEHNQDILRQPPQWSNSNREA 412
gi 564329135  287 -YFEHNDNDYDIDFVPPSPEE-II--STASSSLKcsSMLKDLDDSDKEKDILSTSKD-LSKPEEMTTPKSDLGTNEDCDA 361
gi 537205252  288 -Y--DDDDDYDVDFVPPSPEEeII--SAASSSSKccSMLKDLDDSDKEKDILNTSKDLLSKPEEMPAKEPDPGTNTDCDD 362
gi 512981741  286 -CVELNDDDY-IDFVPPSPEEeSI--SASSSSLKcfSALKDLDASDQEEDVLSTSKDLLSKPEKMTTQEPNPEISTDCDA 361
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap