Conserved Protein Domain Family
Mon2_C

?
pfam16206: Mon2_C 
C-terminal region of Mon2 protein
Mon2 proteins are found from fungi to plants, to human and is a scaffold protein involved in multiple aspects of endo membrane trafficking. This C-terminal region is essential for Mon2 activity.
Statistics
?
PSSM-Id: 318446
View PSSM: pfam16206
Aligned: 2 rows
Threshold Bit Score: 1467.28
Threshold Setting Gi: 914912277
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950  917 TDFLTVMPWRCLPLCISTAAKFGSQTQELNISLTAIGLMWNISDFFNQ----------NQDKLMSTQLQDVAIL---PEF 983
gi 914912277  934 TDFLPTMPCTCLQIVVDVAGSFGLHNQELNISLTSIGLLWNISDYFFQrgeiiekelnKEEAAQQKQAEEKGVVlnrPFH 1013
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950  984 PGtvkmPQFDKLWMCLYAKLGELCVDLRPAVRKSAGQTLFSTISAHGSLLNPPTWQALVWQVLFPLLDNVRALSSSASNE 1063
gi 914912277 1014 PA----PPFDCLWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAHGTLLQHSTWHTVIWKVLFNLLDRVRESSTTADKE 1089
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1064 KVDA-SGNILIHHSRNTAQKQWAETQVLTLSGVCRVFNTKRELLQMLGDFERAWSLILEFIQNAALSKNGEVSLAALKSL 1142
gi 914912277 1090 KIESgGGNILIHHSRDTAEKQWAETWVLTLAGVARIFNTRRYLLQPLGDFSRAWDVLLDHIQSAALSKNNEVSLAALKSF 1169
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1143 QEIMYHNTTTERT----------------VGGVGGASLKDPQTAQEQDEEIWTYLKSIEKQFSTFRVNHMELFFIAWNIW 1206
gi 914912277 1170 QEILQIVSPVRDSdkpetspvvnvpvpvlIGPISGPGLSRPFIRTDSIGERLGRYSNSEPPIVTDELEDLNLWWAAWNTW 1249
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1207 LSIGMESTKmsttkaqpqPSSNggsngsqdSQEDFYIPSQAFLTALIQIFPAIFHHIQVKFSPTDFDKFCTVLTNAVCIP 1286
gi 914912277 1250 YRIGSESTK---------PPIT--------FDKLTFIPSQPFLTALIQIFPALYQHIKTSFNMDDLQKLGVILHSAVSVP 1312
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1287 VQTDAVPYIMSTVSDTLLTPLHDGILDCMELIQKEA--TKPDSHI--SqlipAIFRQLLIFSKFACAPPtfqqnvehKYA 1362
gi 914912277 1313 ISSDASPFILPSYTEAVLTSLQEAVLTALDVLQKVIcvFEKNNQIlyK----KIFFKLLAFVEFSCKPP--------QYG 1380
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1363 KSTSGHYANN--------ASVEVVGMNYIPFGEKSISICVKLYQTTATEesvvqeqilhDIVKAVRTPLAMKYKCLSSST 1434
gi 914912277 1381 QLETKHIANAkynqiqlfAPAEWVALNYVPFAERSLEVVVDLYQKTAYY----------LYFQALRVPLSLKYSCPSEST 1450
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1435 WKLAISSLISVLHTGLKVAR--AKPQHFASLWDDLADTLDKFLFPASVcTIEDRGLEEIVLDETIDCHVIELLRDEVLPH 1512
gi 914912277 1451 WKLAVSSLLKVLSIGLPVARqhASSGKFDSMWPELANTFEDFLFTKSI-PPDNLSIQEFQRNESIDVEVVQLISTEILPY 1529
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1513 AHEMPHQFIMQIVVLLNKGSIHSASDTNICYESDWKLREIFAKTCFETLLQFSLledhhatnNNRINAnllPAgaagavg 1592
gi 914912277 1530 ANFIPKEFVGQIMTMLNKGSIHSQSSSFTEAEIDIRLREEFSKMCFETLLQFSF--------SNKVTT---PQ------- 1591
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195172950 1593 KDFAGRLAVTALLHRFQEVLKRFNDDERQSGKCPLPRFRLSEISFVLKAIATLVVSMKKAPASKVNKPAWDQLIGLYPYL 1672
gi 914912277 1592 EGYISRMALSVLLKRSQDVLHRYIEDERLSGKCPLPRQQVTEIIFVLKAVSTLIDSLKKTQPENVDGNTWAQVIALYPTL 1671
                         810       820
                  ....*....|....*....|....*....
gi 195172950 1673 VDCTTTTSPEVSRSLREALLQYTDLLQAP 1701
gi 914912277 1672 VECITCSSSEVCSALKEALVPFKDFMQPP 1700
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap