3ZNV


Conserved Protein Domain Family
Peptidase_C101

?
pfam16218: Peptidase_C101 
Click on image for an interactive view with Cn3D
Peptidase family C101
This is a family of cysteine-peptidases that is conserved in vertebrates. The key residues as found in human OTULIN are Asp126, Cys129, His339 and Asn341.
Statistics
?
PSSM-Id: 318458
View PSSM: pfam16218
Aligned: 18 rows
Threshold Bit Score: 427.885
Threshold Setting Gi: 405975837
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZNV_A         4 SVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMllpEK 83
gi 637290816 212 SVESEVDIMDYCRKEWRGNTAQAKCIRKGYEAVSQRFISIRRVRGDNYCAVRATLFQALSQATQLPDWLQREEIImlpQK 291
gi 326917160 113 SVAPEMDILEYCEKEWRGNTPVARRMRKGYEAVAQKFASIRQVRGDNYCALRATLFQALSQATQLPRWMQSEDFTmlpEN 192
gi 297674991  81 SVAPEMDIMDYCKKEWRGNTQKATCMKKGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELTllpEK 160
gi 260447042 121 SVSAAEDLQTYSEKEWRGNTTKSQLIRKGYEAIASEF-RLCRVRGDNYCALRATLFQVLSQSKKLPAWLQDSDIVkwpKE 199
gi 528519421 579 SLASAVDILAYSEREWKGSTDKSARIRKGYSEMSHSFSGLRRVRGDNYCALRATLYQVLATSTNMPTWMQDESFLllpES 658
gi 551494189 302 SLSPAVDILSYSEREWKGNTAKSALIRKGYKEMSAKFSHLRRVRGDNYCALRATLFQVLSQSVQVPQWLQDDTVLmlpKQ 381
gi 768931184 116 SLAPAMDILSYSEREWRGNTAKSALIRKGYTEMSSRFSSLRRVRGDNYCALRATLFQVFTHSTQLPSWLQDEDVAmlpDQ 195
gi 734641748 459 SLAPAMDILSYSEREWKGNTAKSALIRKGYKEMSQRFGRLRRVRGDNYCALRATLFQVLSHSTQLPVWLQEEDITmlpKQ 538
gi 542217845 395 SLSPAVNILLYSEREWKGNTPKSALIKKGYKEMSQSFASVRRVRGDNYCALRATLFQVLSHSTQLPTWLQNEDVImlpKQ 474
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZNV_A        84 LISKYNWIKQWKLGLKF--DGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLN 161
gi 637290816 292 LTIKYDWIGQWQLRQKA--TNNVENLVVEIEECLMLLKRKWKNMTELKTLAERQAACDELFRSEDDEYKLYEAVKFLMLN 369
gi 326917160 193 LLSKYDWIKQWQLKQNP--SRKTGEISDEIKEYLLLLKKKWKCVSDIKCSVEKQEACDELFKNEEEEYSLYEALKFLMLN 270
gi 297674991 161 LISKYNWIKQWKLGLKF--DGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEEEEYSLYEAVKFLMLN 238
gi 260447042 200 LHSDENFLKEWQFPLE-----SKKNNVQHLEQCLDLLKKKWQEAVQCKSLAERERMSQQVFRGLNEEYELLEALKFLMLR 274
gi 528519421 659 IETREHLIGGWVFPPQCk-LGSEENSVEKLKYYLGLLKTQWRAAVACESPEEKQSLCEHVFQGGDEEYGLLEALKFLMLA 737
gi 551494189 382 LKAQEGLISQWRFPGQHapGDGAGDPTERLKGYMELLRKTWQAAAERPGSAERQQLCERLFQGEEEELGMLEALKLLMLG 461
gi 768931184 196 LEAQEGLISGWSFPGEClqGDGRGDAILQMKGYTKLLRAKWQAAVDCPSVAERQRLCERLFQGGEEELGLLEALKLLMLA 275
gi 734641748 539 LEAQEGLISHWTFPGDClqGDGTGDAALQLKGYMELLRNKWQAAVDCSSAAERQQQCERVFQGGEDELGLLEALKLLMLG 618
gi 542217845 475 LEAQDGLISQWTFPGVClqRDGTGDAVQQLKGYMELLRNTWQAAVDCATDAERQQLCEQVFQGGEDELGLLEALKLLMLS 554
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3ZNV_A       162 RAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITV 241
gi 637290816 370 TAIRLYEDNEKGKEVPVFAWLLFARDTSSNPSQLMENHLNQLGHTGGLEQVEMFLLAYALQHTIQVYRLYKYSTDEFIAF 449
gi 326917160 271 TAIQLYNDEKNGRRVPVFSWLLFARDTSSNPCQLMHNHLNQIGHSGGLEQVEMFLLAYALQYTIQVYRLYKCSTDEFITF 350
gi 297674991 239 RAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITV 318
gi 260447042 275 TAAQLHLNMEKGSDVPEFCWLLFARDSSKCPKTFLTNHLRHVGFSGGLEQVEMCLLGHSLQQTIKVFRLYKCDTEEFITY 354
gi 528519421 738 KAIELHRKMVTDQEVPVFCWLLFARDTSENPQSLLANHLSQIGFSGGVEQVEMFLLGYALNYTIQAFRLYMTDTEEFVTH 817
gi 551494189 462 RAAELHGHMQAGQDVPLFCWLLFARDSSDCPRSFLSNHLRHVGLSAGLEQVEMFLLGYALQHTIQVYRLYKANTEEFVTF 541
gi 768931184 276 RALELHGRMQAEGDVPLFCWLLFARDSSDCPRSFLSNHLSHVGLSAGLEQVEMFLLGYTLECTIQVYRLYKADTEEFVTF 355
gi 734641748 619 RAVELHGCMQAGGDVPLFCWLLFARDSSDCPRSFLSNHLSHVGLSAGLEQVEMFLLGYALQCTIQVYRLYKADTEEFVTY 698
gi 542217845 555 RAAELHSCMQGGEDVPLFCWLLFARDSSDCPRSFLSNHLSHVGLTAGLEQVEMFLLGYALQCTIQVYRLYKADTEEFVTY 634
                        250       260
                 ....*....|....*....|....*.
3ZNV_A       242 YPTDPPKDWPVVTLIAEDDRHYNIPV 267
gi 637290816 450 YPNEPEEHWPVVTLITEDDRHYNIPa 475
gi 326917160 351 YPNDPEEDWPVVTLITEDDRHYNILV 376
gi 297674991 319 YPTDPPKDWPVVTLIAEDDRHYNIPV 344
gi 260447042 355 YPNDHKNDWPHLVLLTEDDRHYNALI 380
gi 528519421 818 YPDDHKHEWPCVCIVTEDDRHYNVPV 843
gi 551494189 542 YPDDHLDDWPSVCLVTEDDRHYNVPV 567
gi 768931184 356 YPDDHRDDWPSVCLVTEDDRHYNVPI 381
gi 734641748 699 YPDDHKDDWPSVCLVTEDDRHYNVPV 724
gi 542217845 635 YPDDHRDDWESVCLVTEDDRHYNVPV 660
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap