4R7R


Conserved Protein Domain Family
DUF4883

?
pfam16224: DUF4883 
Click on image for an interactive view with Cn3D
DOmain of unknown function (DUF4883)
This family consists of several uncharacterized proteins around 160 residues in length and is mainly found in various Clostridium species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318463
View PSSM: pfam16224
Aligned: 18 rows
Threshold Bit Score: 100.024
Threshold Setting Gi: 492316109
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4R7R_A         8 NYHTKNL-SELVS--KNNIKIRLLDXNIYSEVIVDNEDVRIIDDLLKSLKDSNFI-N---EEAL-PNKPLYKIFIDLNS- 78
gi 81767527   36 NYHTKNLsE-LVS--KNNIKIRLLDMNIYSEVIVDNEDVRIIDDLLKSLKDSNFIn----EEAL-PNKPLYKIFIDLNS- 106
gi 551002461  37 HYYTDELrNKILS--NEKFTLYVFDTNLYKEIEVPSEENSIFENFTNTLTNDNYI-----DDKV-DAKEPFRLKVVFKD- 107
gi 503056712  34 NYYTNLFiQNMNT--NKIKSISVYETNYSKDKVLNTELYYIIKNLFDSLKKENFL-De--PMYT-PENPVYRYYITFSN- 106
gi 505207360  37 HYYIDKIkNRILN--NYKYKLYVFDTNLYKEFQIPDEEDNIVEDFISSINSDAYT-----DETI-TSKEPFKLTIIFDNg 108
gi 524362076  36 YYYSDELySKLKE--NPSFTLQVFDCVLYKYYDVPKEDYDIAESFLTSLRTENYL-TelpDKYK-KSKPQYRLIISLGS- 110
gi 500664248  37 HYYIDEIkSKILN--NQNFTLYVFDTNLYKEIEVPSEENSIIEDFVSALTTVNYS-----DESV-DAKEPFRIKILFED- 107
gi 496460763  37 HYYIDEIkNKILN--NKKFTLYVFDTNLYKEIEVPADENSIFEDFISSLATENYS-----TEGV-NVKEPFRIRLYFND- 107
gi 501393154  37 HYYTDLLtNKVLN--NEDFSLYVFDKNLYKEIKVNDDEEVMVENFLNSLITDNYL-Nn--SDLI-NEREPFRIKVVFKD- 109
gi 492316109  41 SLYTNNLiKTINNsaNSNLTISIFYSKLGKNKTIPKEYIENISSFFNSLKPEYFLdYs--TSNLdTKNPEYRLTVYLNE- 117
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
4R7R_A        79 EK-YVIDIYGDDLITLYPWDSDVRKDYLS-LKDIPNSFKLEPF 119
gi 81767527  107 EK-YVIDIYGDDLITLYPWDSDVRKDYLS-LKDIPNSFKLEPF 147
gi 551002461 108 DK-YLIKVFNDSVVSICPWDGNYKEDIVS-IKNLPLRYNLYDF 148
gi 503056712 107 DKtFVIDVYNENYLTLYPWDGKYQKDFID-ISNAPKSYNLHGL 148
gi 505207360 109 EK-YLIKVFNSSIISVAPWDGFYKEDVIS-IKDLPLKYNLFDF 149
gi 524362076 111 SK-YIINAYSTELDTIHPYDGSFQEDIIDsTKNVDARNNIYDF 152
gi 500664248 108 NSqYLFRIFNDSTISVSPWDGNYKEDIIS-IKDLPLRYNPFDF 149
gi 496460763 108 NDqYFVKVFNDSIISVAPWDGIFNEDIIS-MKNLPLRYNLFDF 149
gi 501393154 110 NI-FLIKVFNSNLITLSPWDGNYAEDIIS-MENLPIGYNLFNF 150
gi 492316109 118 KSiFVIDILNDKYITIYPWDGSYEPDLID-ISNLHTRTNLFNI 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap