Conserved Protein Domain Family
Pyrid_ox_like

?
pfam16242: Pyrid_ox_like 
Pyridoxamine 5'-phosphate oxidase like
This domain, approximately 140 residues in length, is mainly found in general stress proteins in various Xanthomonas species. It is composed of a six-stranded antiparallel beta-barrel flanked by five alpha-helices and can bind to FMN and FAD, suggesting that it may help the bacteria to react against the oxidative stress induced by the defense mechanisms of the plant.
Statistics
?
PSSM-Id: 318476
View PSSM: pfam16242
Aligned: 23 rows
Threshold Bit Score: 169.004
Threshold Setting Gi: 500074817
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123058698  20 D-SIDKIIELASD-QTCFLCTTQ-GAKGNARPMAVQKVDKQGNIWFLSASDSNQNKEIQENSS-VNLYFKGNQHSDFMHL 95
gi 123738281  23 eqpARQLWDQVNGvHAGMLGIS--GLDMHMQPMAPHADPTTNTIWFYTKTDADIVRAIKPGSR-AHFCVIGKDHDYHACL 99
gi 503345272  14 D-AVKKIGELIKDvRICMMVTAGsDGSFDSRPMATQATEFDGTVYFLTRGDSGKVGEIQQDQH-VGLIYSDPSNHNYVTA 91
gi 502933148   8 E-AIDHVWEMMEDiRTCMLVTKQ-GLTLRGRPMHAFPSREEGCIWFLTDRRGHADDELRRDPQ-GALTFANASKNDFLSV 84
gi 502838094  10 E-ARKKLKSLVDDiKTCMMVTNIgSKPVDAIPMTTKKIDTEGNIWFLSGLNSDHNTNIVKDND-VQLLYSDVKDFEFISI 87
gi 503035751  10 D-AEQEFWKHLKSsNTGMLGId--TPGYHSQPMTAYREEETGTIWFFTRDDTDLARDIAKGGQsGMFTYGSKDQEVWACF 86
gi 503715061   3 D-TKEHLHDLLKDfSGAMLTTRTaQGGLHARPMTIAKLADNEELYCATGLSSPKIAEISNDPH-VSVTFQVTS--EYAAL 78
gi 506397309  10 E-PARQLWEEIEAiHAGMLGLE--GSTTHMQPMAPYGDPKTNTVWFFTRTDSDFVQNIRPGSR-AHFCVVGKNHDYHASL 85
gi 500935702  10 EfAVNKIKDLAENiKTCMFCTYN-SDRLQSRPMSVQKIDDLGRLWFLSDRNSSQNAEITLNPQ-VEIFF-SEPHDKFLTL 86
gi 506286761  10 E-ALKKLKELSESaRICMFCTDLtSLPITVRPMSLQETDTEGNLWFISSDASNKNFQIAEDNR-VQLLFMNNSNSEYLSV 87
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 123058698  96 YGEATVLRDETIIKELWNPVLKTWFTEGENDPRITIIKFTTKEGYYWDTkHG-NFIAGIKMLIGAATGQT-LD 166
gi 123738281 100 SGVIEVRNDPSKIEEYWSSMVAAWYDGGKKDPKLTMLSLHVDDAEIWVStGS-TLKFGWEIAKANLDDDKmpd 171
gi 503345272  92 KGKASVSHDKAKIHELWNPMFKAWFPEGEDDPEVTVIKVTVSEAQYWEAsSS-KLVFGIKYLAAAVTGGK-VD 162
gi 502933148  85 SGECEVSDDRAKVDELWNDAARAYWPEGKGDPNIRVLRFLPSDAEYWDGtAS-SIMITLKMAAARLKGER-AD 155
gi 502838094  88 FGKAAIVTEKDILEDLYSKVDDTWF-RGTDDPNLSAIKVNPEEAYYWDTkSN-KYVSLFKMGVSAITGDQ-KD 157
gi 503035751  87 HGTLSLHRDQAIIDKHWNPIVAAWYPDGKEDPHLTLIKFDGDDGRVWVSkKG-AAGFFFEIAKANLTKTM-PN 157
gi 503715061  79 YGVARVVRDRETIEKLWSETWRIWFAGGKDDADLCLLAISPKSGEYWDNsGSrCVKYLFSGKKAVLQKST-PE 150
gi 506397309  86 SGVIDVRRDPSKIDEYWSSVVEAWYHNGKKDPDLTMLALHIDDAEVWAStGN-PLKFGWEIAKANIDGEKlPD 157
gi 500935702  87 HGTATISYDRETIKELYDPIVKVWMPGGEDDPNLSVITVTPEDGYYWNNkHG-KMVAIAKMATALVTGKT-MD 157
gi 506286761  88 FGNAYIYKDKATIEDKWSNLASAWFEDGKDDPNVSIIRVAPEDTYYWDTkAG-KLVSLISFAAAAISGTK-TD 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap