3K9T


Conserved Protein Domain Family
DUF4910

?
pfam16254: DUF4910 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF4910)
Statistics
?
PSSM-Id: 318483
View PSSM: pfam16254
Aligned: 26 rows
Threshold Bit Score: 538.359
Threshold Setting Gi: 160338950
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K9T_A        20 YNLIEELFPICRSITGNGVRKTXDIIRKHI-P---LEIHEVKSGTKVFDWTVPKEWNIKDAYVRNSK-GEKVIDFKENNL 94
gi 122952777  19 YELACELFPIPRSITGQGFRDSLEILNKTL-GggiLKFHSIKSGTKVFDWIVPDEWNVKEAYIITPK-GEKICDFKKHNL 96
gi 81701884   18 YRLLAELFPLCRSITGDGVRETLRIIQGQI-P---LRLVEVPTGTQVFDWTVPREWAIRDAHISDSN-GKRIVDFRSNNL 92
gi 81566809   23 YKWACDLFPVCRSLTGDGVRTTLDYLGNVM-Gg--LGLHEIPSGAACFDWNVPDEWNIRSAFVMDEN-GNKVIDFARNNL 98
gi 503014431   2 YRFISELYPICRSITGQGIRDTFGRIQQHI-P---LSITAVPSGTQVFDWTVPLEWNIRDAYVADRQ-GVRVIDFKQSNL 76
gi 504965230  28 YQTISRLYPICRSITGNGVRETLKILQEHI-P---LEIAEIPTGTEVFDWTIPKEWNIKDAYIKNSR-GEKIVDFQECNL 102
gi 568207982   5 YDWARDLFPLCRSLTGDGVRRTLSYLADLL-Pg--LEIHEVPSGTQAFDWTVPDEWNITDAYILGPD-GTKVVDFADSTL 80
gi 501717853   5 HSFLQRLFPICRSITGNGVRQTLSILKEEL-Pa--LQLHEVPSGTPVFDWTVPDEWNITEARLTGPD-GEVIADFAHCNL 80
gi 501645287  11 YRWMADLFPICRSLTGDGVRETLRYLGDLL-Pg--LRLHEVPSGTQCFDWTVPDEWNIRDAWVADMQ-GNRLIDFKASNL 86
gi 312939440   8 HDLIRRLFPINRSLTGKGFRKSLEIIKEYVsG---LEIKHIESGEKCFDWTVPDEWDVEEAYLEEVDsGKRIVDFRNNNL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K9T_A        95 HVXSYSVPVHKTXTLDELKPYLHTIPGNKDRIPYLTSYYKENWGFSLTQNKFDEL-CDDDYEVVIDSSL-EDGSLTYGEY 172
gi 122952777  97 HLLNYSEAIDQEIELEELQDHLYSIEEMPDAIPYVTSYYKRRWGFCLTHNERKKL-KKGKYKVYIDAKHdENGVLDYADF 175
gi 81701884   93 HVVGYSVPVDRTISLAELQNHLYSLETMPDAIPYVTSYYQERWGFCLTHRQRSGL-PDGEYRVFIDSEL-KDGHLTYGEL 170
gi 81566809   99 HVVGYSEPVDVTLSLDELQQHLHSLEEQPDAIPYVTSYYRRTWGFCLSHNERMAL-RPGNYRVVIDSTL-APGFMTYGDV 176
gi 503014431  77 HVVSYSTPIAARMPLRELKAHLFTLPDHPDWIPYRTSYYKESWGFCLSHRQYLDL-RDEDYDVVIDSSL-KPGHLTYGEY 154
gi 504965230 103 HVVNYSVPVHKTVSLSELKAHLHTLPEYPDRIPYRTSYYKETWGFCLSHTQFLSL-EEEEYEICIESSL-EPGYLTYGEY 180
gi 568207982  81 HVVGYSEPVDMVLGLDELQDHLYSLPETPDWIPYVTSYYRRHWGFCLSENRRRQL-QPGEYRVVIRSTL-APGALSYGEL 158
gi 501717853  81 HVVGYSEPVDIHLSLDDLQEHLHSRPDLPEAIPYVTSYYARRWGFCLKHSIRQKL-KPGTYHAVIRASL-EPGHLSYGEF 158
gi 501645287  87 HVVGYSEPVDTVVTREELDARLYSLPDQPDAIPYVTSYYKRTWGFCIAHDKREAL-GPGPFRVVIDSTL-APGHMTCADL 164
gi 312939440  85 HLVGYSIPVDVVLNFEELDKHLHYREDLPDAIPYVTSYYNPYWGFCLSYNQYKNLdRNKKYRAVIKSRL-FRGVLNYGEI 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K9T_A       173 YIRG--ELEEEILLTTYTCHPSXCNDNLSGVALITFIAKALSKLKT-KYSYRFLFAPETIGSITWLSRNEDKL-K-N-IK 246
gi 122952777 176 ILPStqNSKDEILISTYLCHPSMANNELSGPVVSIFLAKWLLGLKErRYNYRFVIIPETIGSIVYLSKHLECL-KkH-VK 253
gi 81701884  171 IIPG--ETDREIFLSTYVCHPSMANNELSGPVVATMLARWIMSRPr-RFTYRIVFVPETIGSLTYLSRNLDRM-KeS-IV 245
gi 81566809  177 VIPG--RSEKTVLLTSYVCHPSMANNELSGPVLLAALARLLRSREn-RLTYRLILVPETIGTIYYLSRHLEEL-KrT-VI 251
gi 503014431 155 YLPG--DTAEEVLISCHACHPSLCNDNLSGIAVATFLAKSLQTSSRrRYSYRFLFLPVTIGAITWLALNQQKV-S-N-IK 229
gi 504965230 181 YLPG--ETREEILISCHTCHPSLCNDNLSGISLATLLAKHLSQIQQrRYSYRFLFIPGTIGSVTWLALNEQNV-N-K-IA 255
gi 568207982 159 ILPG--ETADEILLSTYVCHPSMANNELSGPVVTTALARWLMTQPKrRFTYRIVFVPETLGAIVYLSRHLEAM-KaK-TR 234
gi 501717853 159 VLPG--QSEKEIFLSTYVCHPSMANNELSGPVVATALARWLQSA-PrRYTYRIVFVPETIGAITYLSKNHQMLrQ-R-VA 233
gi 501645287 165 FLPG--RSEKTVVLSTYVCHPSMANNELSGPVLQTAMARHLMQRDr-ELSYLLVFVPETIGTIWYLSRHLAEM-Q-RnVV 239
gi 312939440 164 IIKG--KTDKEIFFSTYLCHPSMANNELSGPVMAAFLANYVKERKDnKYTYRFIFIPETIGSICYISKNLENM-KkN-IV 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3K9T_A       247 XGLVATCVGDAGIKNYKRTKFGDAEIDKIVEKVLXhCGSEYYVADFFPWGSDERQFSSPGINLSVGSLXRSCYG-FDGYH 325
gi 122952777 254 AGFVLSCLGDDHTYSLIHTVKENTLSDKVALHTLK-NKENFKAFSFLDRGSDERQYNAPLVNLGIVGVCRTRYGdYDGYH 332
gi 81701884  246 AGFNLTCIGDDRAYSFLPSRSGSTLADRAALNILGhKHPDFIRYSFLDRGSDERQYCSPGVDLPVVSVMRSKYReYPEYH 325
gi 81566809  252 AGFVLSCVGDDRDYSYLPSRRGNTLADRVLRHVLDaYHPGYSRYTFLDRASDERQYNSPGVDLPVIPFARSLYRrYPEYH 331
gi 503014431 230 HGFVLTGVGDEGGFTYKKSRVGHADIDEAFAHVLRhSGESFEVTEFIPYGYDERQYGSPGFNLPVGCFMRRANGgYPEYH 309
gi 504965230 256 HGLVVTGVGDAGKYTYKRSRRGDTQIDRAAIHVMQhSGSEYQVIDFFPYGYDERQYCSPGFNLPVGCFMRSSHGqYSEYH 335
gi 568207982 235 AGFVLTCLGDDRAYSFLPSRLGGTLADRAALHVLArHAPDFTAYSFLTRGSDERQYCSPGIDLPVVSVMRSKYAtYPEYH 314
gi 501717853 234 AGFNLTCLGDDRAYSYVPSRKGNTLADRAALHVLRhFAPDFVRYTFHDRGSDERQYCSPGIDLPLCSVMRTKYHaFPEYH 313
gi 501645287 240 AGFVLSCTGDDRAWSYLPSRHGNTLSDRTLLHVLGaYHPDFKRYTFLDRASDERQYNSPGVDLPIIPFARSLYRhYPEYH 319
gi 312939440 240 AGFVLTCCGDEGKFSYVPSRYGDTIADKVALNLLKyELDEFKEYSFLDRGSDERQYCSPGVDLPVCSVMRSKYGtFKEYH 319
                        330       340       350
                 ....*....|....*....|....*....|.
3K9T_A       326 TSADNLCYXNKDGLADSYKTYLEVIYTIENN 356
gi 122952777 333 NSKDDLNFISEKGLMGGLQSMQEMILNLEIN 363
gi 81701884  326 TSLDNLDLVTPAGLQGGFSAVRDCLELLENN 356
gi 81566809  332 TSLDDLSVISPEGLQHSFETMLRCIDIMEGN 362
gi 503014431 310 TSGDNLDFVKPTSLSRSLQVVQSVVEVLESD 340
gi 504965230 336 TSADNLSFVQPEYLGDSFAKFLSILHVLENN 366
gi 568207982 315 TSADDLDLISQAGLEGGFTLLQRCLQVLEAN 345
gi 501717853 314 TSLDDCSLVTEKGLQGGFEIMRKILETLEED 344
gi 501645287 320 TSLDDLSVVSAAGLDNSFTTLARCLDIIENN 350
gi 312939440 320 TSLDNLDFVTPKGLEETFEFYKKVINILENN 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap