4M8K,4NRD


Conserved Protein Domain Family
Lipase_GDSL_lke

?
pfam16255: Lipase_GDSL_lke 
Click on image for an interactive view with Cn3D
GDSL-like Lipase/Acylhydrolase
Statistics
?
PSSM-Id: 318484
View PSSM: pfam16255
Aligned: 5 rows
Threshold Bit Score: 385.016
Threshold Setting Gi: 534286848
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8K_A        21 KKVSILGDSYSTFYGHVSPAANLCWY-GVPGEKKENDVTKVEETWWYRFIHEHGFQLERNNSYSGSTVCHTGYEKADYSD 99
gi 524695476  24 KKVSILGDSYSTFYGHVSPAANLCWY-GVPGEKKENDVTKVEETWWYRFIHEHGFQLERNNSYSGSTVCHTGYEKADYSD 102
gi 495917624  24 KSISILGDSYSTFEGYLQPDTNSIWY-YVS-PRQQTDVTSVKQTWWHKFIKENNYRLCVNNSFSGATICNTGYRNEDYSD 101
gi 500648120  24 KSVSILGDSYSTFEGYVQPDTNFVWYlKTPPKGRKTDMVSVRNTWWHQFIKENNYRLCVNNSFSGATICHTGYRSEDYSD 103
4NRD_A        23 KSISILGDSYSTFEGYLQPDTNSIWY-YVSP-RQQTDVTSVKQTWWHKFIKENNYRLCVNNSFSGATICNTGYNQADYSD 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4M8K_A       100 RSFITRIHNLGTPDIILVFGGTNDSWAGAPIGAYQYDGWTKADLYSFRPAFCYLLASLKQLYPAARIYNITNSELSEEVT 179
gi 524695476 103 RSFITRIHNLGTPDIILVFGGTNDSWAGAPIGAYQYDGWTKADLYSFRPAFCYLLASLKQLYPAARIYNITNSELSEEVT 182
gi 495917624 102 RSFITRMDQLGCPDVIFVFGATNDCWAGSPLGEYQYVGWAKDDLYKFRPAMAYMLDHMIDRYPNVEIYFLLNSGLKEEFN 181
gi 500648120 104 RSFITRMKALGCPDIIFIFGATNDYWAKSPLGEYKYADWSKKDLYSFRPAMAYMLDTMIDYYPNVEIYFLLNDGLGNEIT 183
4NRD_A       101 RSFITRXDKLGCPDIIFIFGATNDCWAGSPLGDYKYEGWTKEDLYTFRPAXAYLLDHXIDRYPNVEIYFLLNSGLKEEFN 180
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
4M8K_A       180 DSXDEICRHYGIENIRLHDIDKQWGHPSVQGXQSIDAQVWESV 222
gi 524695476 183 DSMDEICRHYGIENIRLHDIDKQWGHPSVLGMQSIDAQVWESV 225
gi 495917624 182 ESVRTICRHYNIDCIELHDIDKKSGHPSIKGMEQISEQIKEFM 224
gi 500648120 184 ESVRTICKHYQIDCIELKELDKMSGHPSVKGMKQISEQVKAYM 226
4NRD_A       181 ESVRAICNHYNIDCIELHDIDKKSGHPSIKGXEQISEQIKXFx 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap