Conserved Protein Domain Family
DUF4915

?
pfam16261: DUF4915 
Domain of unknown function (DUF4915)
This family consists of uncharacterized proteins around 370 residues in length and is mainly found in various species, such as Shewanella, Rheinheimera, Saccharophagus, Leptolyngbya and so on. It contains serveral TPR repeat-containing proteins. The function of this family is unknown.
Statistics
?
PSSM-Id: 318490
View PSSM: pfam16261
Aligned: 46 rows
Threshold Bit Score: 300.988
Threshold Setting Gi: 504620949
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123580093   12 NGLSQWLHQQQMSLACTTYQSNRLFFVGCKKEgEQLALHERLFDKPMGLWWQPDM--------LLMGCRYQLWELDNR-- 81
gi 122373434   15 PNMPELLWELGGTLVLSTYQAGKIIFMSAPDR-EGIVQLPRQFDKAMGVAVQGDK--------LAVATRSEVQVLANApl 85
gi 506437414   17 SNFSPLLNHLKLSLVISTYQAGKLVIARPDGN--VLNTHFRVFNKPMGLATDYGR--------IAVGCAYQIWELRNVpa 86
gi 504978655   30 SNFPQILSQLGISLAVTTYQAGKIIIVRADGE-N-LNTHFRVFKKPMGMAMTGNQ--------LSLGSGPQIINFRNMpn 99
gi 504948955   46 QNFRDILVECGISLVISTYQADKVVVVRADRQ-E-LNTHFRVFEQPMGIAADHER--------LALGTAFEVWELRNVpa 115
gi 501111229   21 SNLTQLLSQNRFSLVVSTYQAGKVILVRADGD--QLNTHFRHFRRPMGLAANATR--------MAIGEAYQLTELYNMpv 90
gi 219863786   17 kNFPGILSELGISLSVSTYQASRLLLLK-GGS-NTLKMDSYLFDQPMGVATDGKR--------LAIGGSTQIWQLGIApg 86
gi 916336562    7 SSVPELLGKTGLSLLMSTYQSGKMVTLREM-D-GVLNTHFTPFPRPMGIAWRPGGganrgtgaLAIGTRDEIWTYRDQpa 84
gi 502900899   19 QNIVKFFKETNTTILLSTYQTNKIMIIGQEND--QFDIRYKEFPRPMGMCKKDGK--------LFAGLGHGIYQFSNYtg 88
gi 609239312   17 PNIPEFFNQAGCTLVISTYQAGKVIFLSALND-ERLVQLPRNFTGAMALGLKDNH--------LAVSEGGRVVVLKSDqg 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123580093   82 L-PQG-QRHE-GGDRLYVPRCSYITGDINAHDVAFDKQGRLLFVNTDFSCLAVYDPDYSFVPIWKPPFISKLAAEDRCHL 158
gi 122373434   86 LaRQY-GTAPgMYDGLYLPRATYYSGEIDLHDMGWGKE-GLWAVNTRFSCLSIIDDDFSFRKKWTPPFITDHTPDDRCHL 163
gi 506437414   87 V-AQK-LEPQgKHDACYLPRNCHITGDIDIHEMAWGKQ-ELWFVNTRFSCLCTLDFDHSFVPRWRPKFISALTPEDRCHL 163
gi 504978655  100 V-AQK-LDPPdKHDACYLPYSTHITGDIDIHEMAYGEDG-LWFVNTRFSCLCTLDRQHSFVPRWRPAYVTALAPEDRCHL 176
gi 504948955  116 V-AQK-LDPPqKHDACYLPRDRHITGDIDIHEMAYCKD-ELWFVNTQFSCLCTLDRKNSFVPRWRPPFISAYDLGDRCHL 192
gi 501111229   91 I-GAQ-LEPVgKHDAYYIPRNVHTTGDIDIHEMAWAKE-ELWVVNTRFSCLCTLENAYSFVPRWRPPFITGLAAEDRCHL 167
gi 219863786   87 T-SSQ-LAPPgSYDACFLPRQTHVTGDIDIHEMAYADD-ELWFINTRLSCLCTLDPAYSFVPRWRPPFVTAYDFSDRCHL 163
gi 916336562   85 V-AQK-IEPKgTYGSCYVMRNRHVTGDIAIHEQAYDREGELWVVNTRFSCLSTIDAEHSFVPRWTPPWISGLGPEDRCHL 162
gi 502900899   89 V-AQN-IEg--NFDACYMPQNIHFTGDIDIHEMEYCKD-QLYFINTKFSCLCIKEPDNSFKPIWKPDFISLLQPVDKCHL 163
gi 609239312   88 L-AAGyPRQPgVYETLFVPRNIYFTGQINLHALEWGEDG-LYGMNTQFSCICTIDDEYSFTPFWTPPNISRLVPEDRCHL 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123580093  159 NGVALCDGEPTYMTACSQTDDAAGWRNCRRDGGVVLSIPDNAVIATGLSMPHSPRWYRNRLWLLNSGTGELGYLD--GAK 236
gi 122373434  164 NGMAMQDGSPKYVTALGTSNIEKGWRTNIQQGGVLIDVPSKEICVEGLAMPHSPRLFDGKLYVLCSATGEVISADpdTGK 243
gi 506437414  164 NGLAMINYHPKYVTALGMSDSFNGWRENKAKGGVIIDVEHNQIIATGLSMPHSPRWYNNQLWVLESGNGSLAKVDlnTGK 243
gi 504978655  177 NGLAMVDGKPKYVTALGETDMAGGWRQNKVNGGVLMDVESKEVLLRGLSMPHSPRRYGDRTWLLESGYGSISQVDlnNGS 256
gi 504948955  193 NGLGVRDQKPRYITALGETNTPQGWRGNKRSGGILMDITTNETLARGLSMPHSPRWYRDRLWVLESGYGSLSTFNfkTGK 272
gi 501111229  168 NGLAVVDHQPKYVTALGTTNTAHGWRPDKASGGILMDVTTNKVLCQGLSMPHSPRWHADQLWVLESGNGAIATVDlkTGQ 247
gi 219863786  164 NGLGLREGQPRYVTALGASDNREGWRSNKARGGILMDIQSNQILCEGLSMPHSPRWYNSNLWVLESGNGSLAKVDlsTGT 243
gi 916336562  163 NGMAMRDGKPKYVSMFSESDQPQGWRDTKAFGGLVMDIESNEILTSGLCMPHSPRWYRDQLFILESGKGTLSRVDldSGE 242
gi 502900899  164 NGFCTRDGEPRYVTMLGLTDEPLGWRANKANGGLLMDIKTNEILIEGLSMPHSPRWHENTLYILESGKGAISHFDfkKKR 243
gi 609239312  166 NGMAMENGRPAFATAFNTGDSKRSWKEGLPGGGVLFHVDSGEVLLEDLQMPHTPRLWDGKLYMLLSATGELICADpeTRS 245
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123580093  237 FIPTTFCPGFVRGLAFNGDYAFVGLSQLR--STSFGGLQLEERLAAMGksaeCGMMVIDLNSGNIIHWLFFTSVVSELFD 314
gi 122373434  244 YEVITKLQGFVRGMCRQGDFIFVGLSKLRknSSTFRDLPIAR--TSMF----CGISVIHLPTGNQVGFIKYENSVEEIYD 317
gi 506437414  244 LETVAVLPGFTRGLDFWGNLAFIGLSQVRe-TAVFSGIPLTEKLTERT----CGVWVVNIQTGETVAFLRFEDAVQEIFA 318
gi 504978655  257 TEMIAQMPGFTRGLDFCGNLAFIGLSQVRe-TAVFSGVPITEKASERN----SGVWVVNLTTGQIVAFLKFEDMIQEVFA 331
gi 504948955  273 LETIVQLPGFTRGLSFWGPLAFVGLSQVRe-TAIFSGLPITESMDSRY----CGVWVVNIETAQIIAFLRFEDAVQEIFA 347
gi 501111229  248 LTTVAELPGFTRGLDFYGPLAFVGLSQVRe-SAVFSGIPLTSRLKERT----CGVWVIHIHTGEVVGFLRFEDAVQEIFS 322
gi 219863786  244 WETIVQLPGFARGLDFCGSLAFIGLSQVRg-SAFFSGIPITQRCQERI----CGVWIVNIENGEEVAFLKFEEAIHEIFA 318
gi 916336562  243 TETITKLPGFTRGLAFIGRYAIVGLSQVRe-S-VFAGIPLTQTNEPRH----SGVWIVDLDTAKIVGFVRFDGLVQEVFD 316
gi 502900899  244 LTQIAKVPGFTRGLDIVGDFAFIGVSKVRe-SATFSGLEIT-KLPKRV----SGVWIVNIKTGQIISFVEFTSGLDEVFA 317
gi 609239312  246 YDVVRKIGGFVRGMAKFGDFVFIAYSRLRqnSSVFARLDIDREHSR------AGVDIIHLPTAAKVGEIRYESSVDEIFD 319
                         330
                  ....*....|...
gi 123580093  315 IVVIPEALQPRAL 327
gi 122373434  318 VQFLPGLKRPAIL 330
gi 506437414  319 VQVLPGLRFPEII 331
gi 504978655  332 VQVLPQIKFPEII 344
gi 504948955  348 VSILSGVRYPELI 360
gi 501111229  323 VAVLPQISFPEIL 335
gi 219863786  319 VTVLPGIRCPEII 331
gi 916336562  317 LQVIVGaggavde 329
gi 502900899  318 ITVLPHKKVEMLn 330
gi 609239312  320 LLIIPDTRRAGII 332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap