Conserved Protein Domain Family
DUF4919

?
pfam16266: DUF4919 
Domain of unknown function (DUF4919)
This family consists of uncharacterized proteins around 230 residues in length and is mainly found in various Bacteroides and Prevotella species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318495
View PSSM: pfam16266
Aligned: 18 rows
Threshold Bit Score: 166.695
Threshold Setting Gi: 503983942
Created: 15-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445381   32 IKEYVTNHNTE--FQKLMQRFEENDTLLTRQDHAMLYYGYSFTPAYKGSMDDf----------QDFRKLIKEEKYEDAYN 99
gi 524258814  63 vrlAVQDRTSPyyYPVLMDRYLRRDTTLTADDYRYLYLGYSFQEDYNPYRVSfynt---aidtLYNRCSHTPEECKELVR 139
gi 524233532  22 IFEQTINNESPyyYPALMLRYNSGDTTLTEKDYYYLYYGYAFSDDYHPLAPIpaedk-vlmafEKAHGDPSEENMRDIIR 100
gi 503849464  33 IKKNIEDKSSNyyYPKLLERMTSNDSLLNNEDYRHLYFGYVFNQKYSSYFRSpdee---klkkYYQSDKINEKDYNEIIK 109
gi 497282364  25 IQNKTMDAESPfyYPSLMMRYNAGDETLTDEDYHYLYYGYAYQESYKPLDSNpdldklllmasGLDPDKPAVETLEAMLY 104
gi 489079361  32 IEKDIQDTQSDyyYPQLMQQLKTGTTVLTASQYEHLYYGYVFQTAYNPYAVFskde----eldTYYKKEPDMEDIPRLQI 107
gi 430786976  23 IEGAVKNRASEmyYPKLLERFQQADATLGLSELRHLYYGFVFHPDYKADKSAqvkds---leviLQKETHSEEDLKQIVS 99
gi 524766179  25 IIRQTLDSESPyyYPNLMLRYQSGDDTMTEEDYHYLYYGYAYQDAYKPLNPNsdmdkamliaqTVDFENPTHESLEKLIS 104
gi 504604850  32 IKAKIQDENSSsyYPNLIERLKLHDPTLTEDDYTNLYYGNVFYENYDPYAFNkeks----dneKELNKQMKAGNFKEAIP 107
gi 547800665  30 IKKYVENQSDD--YQQLIERFEANDSLLSLNDYALIYYGHSFTPKYKGSMELw----------KELETLMEEKKWEEAYT 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81445381  100 IGKELLKKNPVSLQLLYNMYGIAGLLQKDiREIKHYSKRYAALLTMIALTGDGTSEETAFKVICVNDEYQLLNMLFkMEN 179
gi 524258814 140 YAHRILADNPFDLRRMAVLVYANNLLDNE-SEVLFWQARIHHLVDAIISTGDGCTPETAWYIIEPVHAYDLLNTLG-VIA 217
gi 524233532 101 YAEEVMRSDPFSPTNLNFLAYAYGAVGDT-LNERINYDRLNKVLAAISASGTGLTEKSPMHVLRFSHASDVLGTLG-LSV 178
gi 503849464 110 LAEHSISLFPFDLRQMNFLAYIYHLKGDE-ISAKNISNRFHKIIEAIISSGNGEKCETGFHVISVSHEYVLLNLFE-L-Q 186
gi 497282364 105 TGEDALARDPFSPKILNLMAYAHGALGNK-LQEKMYYNRMQGVIRAIRESGDALTQKTPRHILMFDHALDVMATEG-LSY 182
gi 489079361 108 LLREALDEFPFDFTAMMFLSYIYHLNGEE-EKSELLSKHFEGFAKAIMASGDGLTCETGLHVIAVEHEHHMLQLFD-L-Q 184
gi 430786976 100 FSEKILDKYPFEINTMNYQLYALEHLGDT-TAYKEVSFQMEMIFETMLSSGDGASKASAFYVIDPAHELILMEALG-LRS 177
gi 524766179 105 AVNDALVQDPFSPKLLNLLAFAYGALGDS-KNEQINYNRMNSILATIEDSGNGLKEGSAWHILMFGHALDLLAAHD-RHY 182
gi 504604850 108 LALAILDKNPIELEPLTFLMIAYGNLKDK-ESVRKFIPAYAELIKAIERSGDGKSKETAYVISSVPDEYQLLYFKK-LTP 185
gi 547800665  98 QLKECRKKNPVSLKLLIYAVNLASELQRE-EEVQAYIDKYIKLSSAIISSGDGTSEDTAFKVISVNDEYQILNNVFkVEG 176
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 81445381  180 MKGQSLVNKCDLIEFDKCQYY---E---G-NQMYFD 208
gi 524258814 218 ESYDFCPPCYDYIQVYDLIG----N---A-RGFYFN 245
gi 524233532 179 AKRLVVSRTTEYITVANENGR---Q---LsKGYYFD 208
gi 503849464 187 NNSQSLVGNCDYMAFEKGKY----K---I-DGMYFs 214
gi 497282364 183 DKSRIISRTVEFIPLTVPYTVegkK---R-KGLYYD 214
gi 489079361 185 HISQSFDGTCDFLALDPEYYT-------L-PGIYFN 212
gi 430786976 178 EDNPQAMGKYDFLELAANDI----G---L-EGLYFD 205
gi 524766179 183 GKARVVSRSVEYVPLLEPVRT---EegrI-KGYYFD 214
gi 504604850 186 ISQKLIDARYDVLEVKDENG----N---V-ENVYFD 213
gi 547800665 177 LKQQSLVNKCDLMEFESSPYY---E---G-TQIYFD 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap