Conserved Protein Domain Family
DUF4925

?
pfam16272: DUF4925 
Domain of unknown function (DUF4925)
This family consists of uncharacterized proteins around 400 residues in length and is mainly found in various Bacteroides species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318501
View PSSM: pfam16272
Aligned: 8 rows
Threshold Bit Score: 432.684
Threshold Setting Gi: 524214476
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81444542   47 LDLTYSGEKLIGKTVSFQTEDSKKGTLTLNDIIPGEKETSF-RINL--SE--QEDNYTFSGET-VSGAGAT-VKYAGSIT 119
gi 524326535  47 LDLTYSGEKLIGKTVSFKTEDSETGTLTLNDVIPGETSTPInGIKLyeNE--EKGNYTFSGTN-ITMGGAT-VKYSGSIT 122
gi 524206819  47 LDLTYSGEKLIGKTASFKTEDSETGTLTLNGIIPGEVTTPIsRIKL--NEngEKDAYTFSGTN-ITMGGVT-VKYNGIIT 122
gi 933264970  49 LVLTYNGDAMNGKSVDFSTVTGETAIITLYDILPGEKAIKItSIPL--SG--DTEGYSFSGNG-MGNETLTtFRYEGRVT 123
gi 524214476  49 LNLSYSDVTLSGKQVKFATTDGRTASLTLMDILPGKAEATVeNIAL--TE--GEGEYIFSGTSpVSRAAEYsVAYSGSVK 124
gi 295085057  47 LNLTYSGEKLVGKTVDFKTEDSEKGTLTLNDIIPGEKQTPL-PISL--CE--QEDSYTFSGKN-ITMGGAT-VTYSGAIT 119
gi 491938211  47 LDLTYSGEKLIGKTASFKTEDSETGTLTLNGIIPGEVTTPIsRIKL--NEngEKDAYTFSGTN-ITMGGVT-VKYNGIIT 122
gi 524206820  49 LVLTYNGDAMNGKSVDFSTVTGETAIITLYDILPGEKAIKItSIPL--SG--DTEGYSFSGNG-MGNETLTtFRYEGRVT 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81444542  120 PKTMKLDL-NVTMPQNQ-WIKTYQMseltrgrgkdvirnqttGE-----------------YEWGE-------SDNQILT 173
gi 524326535 123 PKAMKLAV-DVKMANSSeLAKSYGF-----------------GT-----------------FEMIE-------NDGEFLY 160
gi 524206819 123 PKAMKLSL-DVTMAHANnLAHTYAF-----------------PA-----------------YSHTT---------NEEAT 158
gi 933264970 124 KGKLTLNIsNIQMGNADlWANTYKL-----------------PEvvngvkkilvgdtwgneYTWQE-------VDGQVLN 179
gi 524214476 125 KGEMTLKL-NVSVPDPKgWVKTYSL-----------------GA-----------------YTTGEftvgdkkYSNWVLT 169
gi 295085057 120 PKTMKLDL-DVVMPQSK-WEKSYSIsnftkgkk--mtvtysgGQ-----------------YIWKE-------T-NEILT 170
gi 491938211 123 PKAMKLSL-DVTMAHANnLAHTYAF-----------------PA-----------------YSHTT-------N--EEAT 158
gi 524206820 124 KGKLTLNIsNIQMGNADlWANTYKLpevvngvkkilvgdtwgNE-----------------YTWQE-------VDGQVLN 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81444542  174 ----AALYTDM-D-LEMVKEAGSLYATVSvIIK-GMGGYLLPQLLKSVTLESDGNITAEYTSDElqlgeqkfseIDMDNp 246
gi 524326535 161 ykfkGAAYLDMiP-KEGFEDGAVMMSVIG-VIGgNILQILIPQLIKDIKIEDNGTIIANYSSDP----------IDMEK- 227
gi 524206819 159 irnsGASYVNI-TtKEGAESIAPIVLQMQ-QMAtNILDVLFPYVLKNITLEKDGIVTANYTTSP----------IDMKE- 225
gi 933264970 180 ----ASCYFHA-D-VEATESGATTQTWGN-GIQ-NIVSYILPQVLQDITLGADGNVTASYSNDPls-------gVDIDV- 243
gi 524214476 170 splyAACAFE--D-LEMSASYSMLFKGLG-GLL-L------PQVLKTVTLEADGNIRAQYYSGA----------IQIDQn 228
gi 295085057 171 ----GGFYVHLdD-VELTKAGSTLFLRMKlIQ--NALCYFIPQLLQTITLQPDGNLVANYTTSPvyigsvpinnIDPDKd 243
gi 491938211 159 irnsGASYVNItT-KEGAESIAPIVLQMQqMAT-NILDVLFPYVLKNITLEKDGIVTANYTTSP----------IDMKE- 225
gi 524206820 180 ----ASCYFHA-D-VEATESGATTQTWGNgIQ--NIVSYILPQVLQDITLGADGNVTASYSNDPls-------gVDIDV- 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81444542  247 asqqqvinfiMMKLMFNTLSADDITAATQGRNYADSPRGLAFWYLKNDL-LYVKLNLPSIISLAMQGQGQTVDAHLIAGI 325
gi 524326535 228 ----------IMSLVGQENAGPEIQKLVNSRTYLPSPTGLAYWSKVNGK-FLLKLNIPAIINEVIKNSQQQVDSGLINGI 296
gi 524206819 226 ----------IMEVANAGKTDAEFRGLIGQRTYVSSPKGLAYWNQTGDKaFVVQLNIPAIISLIAENNGQQIDPQLIAGI 295
gi 933264970 244 ----------IFGFLETPLTQEMITPNIADRKYIPSPKGFATWFQKDGK-LILKLNLANIISSIASSSDTYMDVNIINAI 312
gi 524214476 229 l--------iFPMLMGQGPSEEVVNALIPTSGELNSPKNLAYWFEKDGK-LYVKLNITSIIAQAMSDSETTGGDETLATI 299
gi 295085057 244 vgt---iatfVTKFMIGLLTEKDINNALTDRTWTASPINLITWTEESGK-LKINLNLPAIISLATKDSETPIDSGLVSGI 319
gi 491938211 226 ----------IMEVANAGKTDAEFRGLIGQRTYVSSPKGLAYWNQTGDKaFVVQLNIPAIISLIAENNGQQIDPQLIAGI 295
gi 524206820 244 ----------IFGFLETPLTQEMITPNIADRKYIPSSKGFATWFQKDGK-LILKLNLANIISSIASSSDTYMDVNIINAI 312
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 81444542  326 ADAILKSNPFLLKTLLGVVSESLDNSLLSMIANMDHQSFQMFFSWIKEGIPMQIEK-ENGHTHIYLNREALSPLIAF 401
gi 524326535 297 TEAIFKTDPIRLKNLLGILNTIINNQVLGYIVNTDETTFSALFSCIKDGIPMNITHtEDGHTYLYLDYQTFTPIINV 373
gi 524206819 296 SEALLKSDPARLKLALSTLNMILNNEIITYILKMDDNTFVTLLSWMRNGIPMGISQaTKDHTYIYLKKETLTPFINI 372
gi 933264970 313 IDAVSQMDAMKVKELLTTLNQSLNNETLGFLVNVNDTSFNAIFNWLTTGIPMQVTS-KEGHTYIYLDKEGFTPIAKL 388
gi 524214476 300 IATVLNGNASTIKQLLSQF-TGLD------FSEISDASFEMLLDWIKNGIPLNVTKaEGGHTYMYLDRTAFDPIFKd 369
gi 295085057 320 MEALAQSNPVQLKLLLGIVNSMIDNPLLGIITSMDTASFQQVFYLLTEGIIFHIEE-EDGHTHLYLTKESTTAFIQL 395
gi 491938211 296 SEALLKSDPARLKLALSTLNMILNNEIITYILKMDDNTFVTLLSWMRNGIPMGISQaTKDHTYIYLKKETLTPFINI 372
gi 524206820 313 IDAVSQMDAMKVKELLTTLNQSLNNETLGFLVNVNDTSFNAIFNWLTTGIPMQVTS-KEGHTYIYLDKEGFTPIAKL 388
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap