Conserved Protein Domain Family
DUF4934

?
pfam16288: DUF4934 
Domain of unknown function (DUF4934)
This family consists of uncharacterized proteins around 400 residues in length and is mainly found in various Bacteroides species, such as Bacteroides fragilis and Bacteroides sp. The function of this family is unknown.
Statistics
?
PSSM-Id: 318512
View PSSM: pfam16288
Aligned: 9 rows
Threshold Bit Score: 181.783
Threshold Setting Gi: 524593713
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443704   40 LKLSDFGNTVRYVPLETNEVCLIGNNPHIALLEDKIVIAT-KDQCFLFHKQTGKYICSIGHIGDDPSGYSST-NYWIDDA 117
gi 81314845   43 LKVSDLGKTIRYIPLETTDSCLIGDFPNIKLLDDKIMVYN-GKQCLLFDKETGKFICSVGHRGDDPEAYSST-CGYLNPK 120
gi 492740858  41 LKVSQLGKNIRYVPLETTDSSLIGNSYNIKLLKDKILVAT-EGSCLAFDKQTGKYLGTIGHKGGDPEGYSEV-VYYIHPQ 118
gi 500647909  41 LKTSQLGKQIRYIPLETTDSSLIGNSYSIKLSKDHIFVST-NGRCLSFNKQTGKYLGSIGHKGEDPQGYSNA-NCFIHPH 118
gi 494933756  44 LKLSELGSDVRYVLLETTDSCLIGGNPNILLLDKQIAVVS-GKNCFLFDKETGKFLTKVGHVGEDPEAYSGP-APTYNDV 121
gi 524760874  45 LKASDYFQTVRYVPLETNDSVLVGDNPKLCVYKDLLIVSSpQEQCYAFSKGDGRFLHPIGHIGNDPEGCSDL-VGWLNAA 123
gi 524761529  44 LKASDYFQHITYIPLETTDSVLVGNAPSIRLAGNRLIVSSaQKQCFSFNKSDGRFVASLGHIGNDPEGCREL-TGWLDAE 122
gi 764963084  44 LKLSELGSDVRYVLLETTDSCLIGGNPNILLLDKQIAVVS-GKNCFLFDKETGKFLTKVGHVGEDPEAYSGP-APTYNDV 121
gi 524593713  43 LKTSDCFKKIRYVALETTDSCLVGQGAYATILNDWIVVTSgRDRCQLFDKKTGRFIRSVGHVGEDPEGYSDVyGGWQNPY 122
                         90       100
                 ....*....|....*....|....
gi 81443704  118 -GLFYFFRAPDQLLKYNQKGEMTG 140
gi 81314845  121 nQLLYFNRDPNQLVKYNQKGNFAG 144
gi 492740858 119 tGILYFHRQPNKLVKYNQDGEFLG 142
gi 500647909 119 tNHLYFYRQPDKLVKYDTKGNYLG 142
gi 494933756 122 dGLLYFMRRPATLQKYDMQGKYRG 145
gi 524760874 124 sGYLYFNRGNKDFSIYHVNGQFVG 147
gi 524761529 123 nGYLYFSKGDGVSAVYDTEGNFIG 146
gi 764963084 122 dGLLYFMRRPATLQKYDMQGKYRG 145
gi 524593713 123 tGQLSFHGWKNEIVVYGADGRFDH 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap