Conserved Protein Domain Family
RSB_motif

?
pfam16294: RSB_motif 
RNSP1-SAP18 binding (RSB) motif
The RSB motif on the Acinus protein is the core around which the ASAP complex is built. The apoptosis and splicing-associated protein complex, ASAP, is made up of three proteins, SAP18 (Sin3-associated protein of 18 kDa), RNA-binding protein S1 (RNPS1) and apoptotic chromatin inducer in the nucleus (Acinus). The ASAP complex appears to be an assembly of proteins at the interface between transcription, splicing and NMD, acting as a hub in the network of protein-interactions that regulate gene-expression.
Statistics
?
PSSM-Id: 318514
View PSSM: pfam16294
Aligned: 28 rows
Threshold Bit Score: 59.8132
Threshold Setting Gi: 556972616
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74961451  467 RSEtppfSRGAGFMD-E-KKARNEERERRREGPR------------------SEERRKVVVeEEEAP------K-----K 515
gi 328712657 687 EDMngdgEKDDKRIK-R-KISDDPHATKD---KKlkkde---------kdlqDKRKKSKSKtPDRIP------T-----K 741
gi 312071163 612 hvlpttqDESAKDFDkR-ERDGRGHERRGRKRSAspvghsetkrarerrspwRDERHHTAS-PEFKPnepekrV-----K 684
gi 156543227 818 DG-----QLHVKEKE-R-ERKEFEKKKRQRSRSPviev-----------hlpAPARKFKKK-EEEPPt-----A-----K 868
gi 357620495 110 DK-----DKEVSRPE-K-MVREERPLEKRRHRTPer--------------spEPARKFKKK-EEEAP------A-----K 156
gi 642923201 732 D------------VR-R-DRS------RSRERSRkhrrt--------pspsdDFITRKQRKaEDSVP------Q-----K 772
gi 242019382 776 DR-----YERKIEYD-R-EKRDDYDDKRRRDKDRnrrs-----------tsaEPSRKTKKKnEEETP------V-----K 826
gi 802742575 234 RGAerekEREERAKK-RaEEGKKEDTTEPRKRRAsersp---------prpaREGKEPRKEeEPAPPp-----K-----K 293
gi 341876594 423 RSEtppfSRGAGFMD-V-KKAKYEDEDRGRRRTDs----------------hSDDRRRELV-KEEPP------K-----K 472
gi 402587595 233 hvlptnqDELSKDLD-KrEREGRGHSHRGRKRSAspighseakrprerrspwRDERRRVTAsPEPKPn-----EpekrvK 306
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 74961451  516 SLDQLFKKTVALPPIYYLPLTEEQIAAKEAEKSAKG 551
gi 328712657 742 SLDELFRKTKTTPTLYWSPLSIEQIAEKEDQRRKHL 777
gi 312071163 685 TADELFLKTKTQPAVYYLPLTEEQIIERTKRKAVEA 720
gi 156543227 869 LLDDLFRKTKATPCIYWLPLTNEQIIVKEEMRRQHM 904
gi 357620495 157 LLDDLFRKTKTTPCIYWLPLSAETIAVKEEQRRQHM 192
gi 642923201 773 LMDDLFLKTKATPSIYWQPLSPEEISMKQQQRLIRM 808
gi 242019382 827 LLDDLFRKTKATPCIYWLPLTPEQISVKEEMRRKHM 862
gi 802742575 294 MASDFFKITKTLPAIYYLPLSEEEANKRAAERKSEk 329
gi 341876594 473 SLEELFKKTIAQPSIYYLPLTDEQVAEKEAKKKEKn 508
gi 402587595 307 TADELFLKTKAQPAVYYLPLSEEQITERIKRKAAEa 342
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap