Conserved Protein Domain Family
DUF4956

?
pfam16316: DUF4956 
Domain of unknown function (DUF4956)
This family consists of uncharacterized proteins around 220 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.
Statistics
?
PSSM-Id: 318525
View PSSM: pfam16316
Aligned: 55 rows
Threshold Bit Score: 95.2682
Threshold Setting Gi: 81450722
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793496    1 MLVLIFGMYYRRHQD--K--ELVTAAALFNIFVFAVLTILSSVEFSVAAGFGLFAILALFTLRSEPITKIEITYFFGSVA 76
gi 81450722   38 KIYKYKTIYTK---------EFIITLATLPVLISMIIFLV---NGNLGTSVAVAGTFGLIRFRSAAGGAKEILYIFFATA 105
gi 490180335  20 AFIIVRFIYYPRKSE--H--NFIFTFLAFNVIVYFIMGLFTSIELSIGAGFGLFALFSILRYRTETVPIREMTYLFVMVA 95
gi 503093614  22 AFIIVRLIYYPKKGE--K--NFIFTFLAFNAVVYFIIGLFTSIELSIGAGFGLFALFSILRYRTETVPIREMTYLFIMVA 97
gi 501216665  18 AIIIVRGIYYTTTPE--R--HFAFAFLAFNVVTFFVLSVLGNIELSLGIGFGLFAIFSVLRYRTEEMPIREMTYLFTMIA 93
gi 490140170  20 ASIIVRYIYYLRNGE--H--TYIFTFLAFNTVVYFIMGLFTSVEISIGAGFGLFALFSVLRYRTETVPIREMTYLFVMVA 95
gi 159891055  19 TLLIVRGVYYPVTQD--K--NFVFTFIGFNMIIYFVLGFLTSVEVGVGVGFGLFAIFSLLRYRTDEIPIREMTYLFILIA 94
gi 503380846  25 VLAVTRGLYSRTQQN--P--DLLFSLLMFGVTIFLVVSVFAGADLSIGFGFGLFAVFGILRYRTGAISTRDLTYLFVVVA 100
gi 504247161  17 TGLIIFGLGYTASRRsrP--EYFFTYLSFSLMAYLVTSLLRDVQLTLGFSFGLLAVFTILRFRSINIAVREMTYLYLAIM 94
gi 489994268  29 VIIGWVYRYTHKNVS--YsqSYVQTLVLVCMVVSVIMLVV---GSNIARAFALVGALSVIRFRNAIKETRDVGFVFLVMA 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793496   77 VAVICS--V---QGTTLPLIAATVVLVLLGAYVFDHPRIVHSV-ENIKITFDQ---IhahAL---SDPKVMNANIAERLG 144
gi 81450722  106 VGIATGmg-------flVLAILFTLTLTLVLWLYENSGFSQVStSRRQATFi--------VP---NNEIDYIPILEKILN 167
gi 490180335  96 LPILNS--Vl-fESGEYTRIAVINLAVIAVIWILENGWGFKNEiMQKEVLYEK---IdlvKA---DKKAEMIEDLKERTG 166
gi 503093614  98 LPILNS--Il-fDSGEYAKLLVIDVLMIVVVWILENGWGFKREvMQKEVVYEK---IdlvKA---GHENELIDDLRIRTG 168
gi 501216665  94 LPVMNAslL---NNGFLELFILANGLVATILFWLERGWGFRQD-SQLRVTYDR---IellAP---RRRAELIADLRSRTG 163
gi 490140170  96 LPVLNSilL---RTGAYAQLLLSDAVIILILWALEKGFGFRPElRRKQVVYEK---IdlvRA---DRREEMIADLRERTG 166
gi 159891055  95 LGVMNSl-M---HSGSLLQIGIANAVILVILFVLEKGWGFQFE-ANKRVAYDKielI---GP---ARSEELLADLRERTG 163
gi 503380846 101 TAMING--L---SAAPFGALLQVNLAVLLALALAQSSFFATPY-SSLMVDYEH---V---AHtaqDHRPELITELRRRTG 168
gi 504247161  95 LPFANA--LfvaTRVSFSDVLIINAGLAIFVVGIDRIQLAYFG-SSQIVHYEKidlI---RA---SNERALLDDLSQRTG 165
gi 489994268 104 IGMTTGtr-------fyTLAIAATVAICLVLVIMNKFNMFKLDvKRQVVKVQ--------VP---P-EPEYTARVEDTLI 164
                        170       180
                 ....*....|....*....|....
gi 81793496  145 VEVVTYEVRAIDYLNDTVSMRVFY 168
gi 81450722  168 KTCREINLISVKNINKNNTIQMEY 191
gi 490180335 167 LNILDVDVLKIDFLRDAAEIRIFY 190
gi 503093614 169 LNVRDVDIRSIDFLRDVAQLKIYY 192
gi 501216665 164 LPVYQVTVGKVDLVRDSAELILTY 187
gi 490140170 167 LDVVRCEVERIDFLRDTAEISVYY 190
gi 159891055 164 IAVKRVEIGRIDLLHDMADLKIFY 187
gi 503380846 169 LDVQQVQLVNLDYVRDMARLRVIY 192
gi 504247161 166 RRVKRYIVEEIDFLRDTALLTVYF 189
gi 489994268 165 EYCSEFELVSTESVRAGALMELyy 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap