Conserved Protein Domain Family
DUF4993

?
pfam16384: DUF4993 
Domain of unknown function
This family around 350 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides species. The function of this family remains unknown.
Statistics
?
PSSM-Id: 318576
View PSSM: pfam16384
Aligned: 3 rows
Threshold Bit Score: 529.1
Threshold Setting Gi: 295086745
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81442965  220 LETIYDVLKKKSDYSDFLDFYSQYSTYAYDKDLSADYGKAVGVDSLFLHAHSPNGLPNIALEWPTPNFRLYPELASISYS 299
gi 524328252 242 LETIYTIMKDKKEYSKFLDFYNSFSTFTYDEQLTADFAKGMGVDKLYLFKHEASGLPNIALEWPVSNYRLIPTLASESYS 321
gi 295086745 213 LETIYTELKNKEKYSTFLDLYDSFGVYVADDELSKSYAKAYGVDTLYQYQH--GGLPNIACEWPTSSYLNFTALTALSYS 290
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81442965  300 IFAPSNQALNTFFNRYWKAGGYSSLTDLDPLITKILLYQSVYGGSIVFPDEI--SGITNSLGSHYDFQLSDVKDKSICVN 377
gi 524328252 322 VFAPTNKALEEFFTRFWKQNGYNYLEDVDPLIIKILILQYIYSGAIVFPDEV--QKITNDYGTSYNFDPYNVKDKSICVN 399
gi 295086745 291 IFAPSNTAINSFFDSFWKIGGYSSMQEVDALALNYFLYQFIYGGSMLFPEELgdDELKNLAGSSLNINPAALNEKTMCVN 370
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81442965  378 GSFYGLSNFPMPEIFSTVMGPSFLKRDYLLSLYAIFQS-NQMAAYTTTATNYTMLITKNSGYEISDMRLMSDGVGNTL-- 454
gi 524328252 400 GSFYGLDEIDTPPIFNSVIGPAFSHKDYRCFLYALDGAeGLLKTYSSLATKYTMLIPDDATFKANEMEVLKTTSGTYAlm 479
gi 295086745 371 GALYGMDEIKEPSTFASVIGPLFQYKSARSFLYALLGS-SLFSSYVSDLSKYIVLVPTAEQFEASGIRTVYSTQGL---- 445
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81442965  455 -ATSGEDGDVAVSTSDLKRIVSGGTVV----GDVNF-NTPWAVYATQDGGTYWFVKDGKMTTNYVFNSVLGQDPQTvIPT 528
gi 524328252 480 ePAETESGMGPVGTAKLQRLINVHTVS----GEVAIpAHGTKVYTSQNASTYWFIKDGEITTNAIFNGVLGMSGND-FSS 554
gi 295086745 446 -EAEGDDGWAEISNTAKQNIVYLHSASisseQSSELpERGTRVIPTESTWNYWFVKDGNITCSSTFNQQL--NPQF-NGT 521
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 81442965  529 LFTEVKEVTNDAGgSWANGKVYEYESDFGVF---GKLDGLEYTSLRTMLTSIG 578
gi 524328252 555 LFSPLEEITNNGE-PWSNGKSYVYKSNRGLFdidGADAGENYRGMKAALATCV 606
gi 295086745 522 VFTPFTKLKNG-----SNGSTYSFDAE-QLF-------AAESGDLAYNIAICA 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap