Conserved Protein Domain Family
DUF5006

?
pfam16397: DUF5006 
Domain of unknown function (DUF5006)
This small family of proteins is functionally uncharacterized. This family is found in bacteroides. Proteins in this family are around 600 amino acids in length.
Statistics
?
PSSM-Id: 318584
View PSSM: pfam16397
Aligned: 5 rows
Threshold Bit Score: 367.603
Threshold Setting Gi: 524327497
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443621    3 KRILYTFLPVCLLATGFAGC-DDDAVEPLPETVPLIIEASGKSFVMGEELTLTVKVN-DEKNPQLTTNEDFDVYLTAK-- 78
gi 81444658    2 KNILYKILPVCLLTIGLTGCeDETKYRPLPEAVPLTMSINEKAFVMGEHLKVDIKVEpDADGNEVVANEDFDIYFTAK-- 79
gi 524326111   6 ewtylWMLPL-LVVVSMSGCsDDDNVSPLAEPVPLKMTLNSTDLVMGEVLEITFDVTgTEEGRK-AMNEDLNIRLSAT-- 81
gi 524327497   2 KKFFYGLLPVCLLALLMTGCdDTETVISIGESRNLVAEISTQSAAIGD--EVTFSVKiDQQDNSLALEEDIDVVLTFTgk 79
gi 524513372   4 KNILYACLPLGIWAMLLTGCkDDDQIAPLPKPVPLTLALESNTLVMGETLNMTFSVK-DEQGAGLAANEDFDIYLAVV-- 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443621   79 --DGEMDVSKiAFKDFPSMVTVPKGVSSFDIKLPIVESGLepKQKLTVNVTAFVRGYAMTNPTQTVVVSDHYYTVVSLKN 156
gi 81444658   80 --AGTEDVAN-VFEPFSSIVTFPKGEKQIQVDFPVKTSGL--VGTTTMEFVAFARGYKMANSSQGIKVSDYYRISMSLEN 154
gi 524326111  82 --TDKGAVDQlVFDDFPSVVTLNKGESTKKVQIPVKKEGL--NKERSVEISAFARGYRMAGALQIVTVSDYHYSKVSLKN 157
gi 524327497  80 nvEGKEVAASdVFDNFSGHIYMKKGEKQGFTEFKVKNNLA--KYPVSGAITAYVRGYKMNAAERPIVLSDKHYTIMSLKN 157
gi 524513372  81 --EGTTDVSKaVFNNFPEMVTFPKGETDLEISVPVKSSGI--TKSVLATLTAFARGYKMDGSEQVVKVSDYYRTTISIKG 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81443621  157 NSDNIINEGDEFTIQVQTPVPVKDDMDINITIPDDQKSLYETLPPvTLTVNAGETLAEAK-VKTKHNLSPTQHETLVLNF 235
gi 81444658  155 NTENVVTEGGKFVLVAKVDKPSSVPLEVTITPKEGEEGRYDNLPS-TLTIPAGRTSVKSAaVTIKQDYEMTGDLQLVLNL 233
gi 524326111 158 NADNTVKEGQTFVLVASVNTTLKDDLTITIIPKAGEEERYENLPS-ELVIPAGANSIESEpVTMKKDVNTTEDEELTLDL 236
gi 524327497 158 NSDNTVKEYGYFVLLATVGAPAKEDVTITINAGD-DADKYENLPD-KLIVKAGYKTAESGfIRIKGEQGPNSFTSVSMSF 235
gi 524513372 157 NSDLVVREGDTFILQMKVEVPAKEDIVVTVTPGAGESDFYENLPS-TLTIAAGELSVESEpITMLADGYPFGDRKLTFKF 235
                        250       260       270
                 ....*....|....*....|....*....|...
gi 81443621  236 TTIS--VMYPLDNDKMEIIMKDLEAGKGSKLLD 266
gi 81444658  234 KSNS--SSNPMTAPALTITMTDLESMADPDLYD 264
gi 524326111 237 ATVPlmSRYPLQATKLTIMKIDIHKNMGSEVRD 269
gi 524327497 236 SSDS--ENHPVYGNEMEIKVTDTDAGlvagtel 266
gi 524513372 236 TSES--VHHPLLSEEMNLTQQDIDTPLGSELED 266
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap