Conserved Protein Domain Family
DUF5027

?
pfam16430: DUF5027 
Domain of unknown function (DUF5027)
This family consists of several uncharacterized proteins around 180 in length and is mainly found in various Clostridiales species. The function of this family is unknown.
Statistics
?
PSSM-Id: 318609
View PSSM: pfam16430
Aligned: 2 rows
Threshold Bit Score: 331.23
Threshold Setting Gi: 524540504
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 502257419  46 EDIVIDNESDIYNIGDEIQVKNVDYGTNREYVAKSYIVNSVKIYDTAAEIDGVQDKLIETDYYMGADPEKPAILKKDEVA 125
gi 524540504  46 EDIVIDNESDIYNIGDEIQVKNVDYGTNREYVAKSYIVNSVKIYDTAAEIDGVQDKLIETDYYMGADPEKPAILKKDEVA 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 502257419 126 CGKLLLCDISVKNIEDEICTVGDISLVYEINGACQLLGYPIYFSNAKDNEHGIYDYTLVQGQSLDAQIGFCVDPALLQID 205
gi 524540504 126 CGKLLLCDISVKNIEDEICTVGDISLVYDINGVCQLLGYPVYFSNAKDNEHGIYDYTLVQGQSLDAQIGFCVDPALLQID 205
                        170       180
                 ....*....|....*....|....
gi 502257419 206 NMDLSKLYLSVNFNGDEENRQFID 229
gi 524540504 206 NMDLSKLYLSVNFNGDEENRQFID 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap