Conserved Protein Domain Family
Phage_TAC_14

?
pfam16462: Phage_TAC_14 
Phage tail assembly chaperone protein, TAC
This is a family of Siphoviridae phage tail assembly chaperone proteins.
Statistics
?
PSSM-Id: 318627
View PSSM: pfam16462
Aligned: 3 rows
Threshold Bit Score: 171.674
Threshold Setting Gi: 289173627
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123520326   9 NLKMSLLKPLNTAQECELLGGRYFICRLSALALLEQEEKATQAFDAGDMRQASLLNVQMLLDCLCDPDGQPIPPEALPSA 88
gi 502755249   3 NLKAALLAPRAHVKAVEIFGTAVNLRRMTATELMDLEDAVEKLSEAGNGREASRLNVQIVLDCLVDDKGKPIPAGDLPTA 82
gi 502752832   3 TLKAALLTPRPQIKAVALFGTQINLRRMTALELLELEEKAETLSDAGNGREASRLNIQMVLDCLVDDKGKPIDKADLPTT 82
                         90       100       110
                 ....*....|....*....|....*....|...
gi 123520326  89 DALMAAHDNGTLLDAIATVKRHAMGSLEDAQKN 121
gi 502755249  83 EELMDTHDNATIIAAINLVKRHSIGTLEDAEKN 115
gi 502752832  83 DELMAIHDNATLIEAIQTVKRHAIGTLEEAEKN 115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap