3S25


Conserved Protein Domain Family
DUF5050

?
pfam16472: DUF5050 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF5050)
Statistics
?
PSSM-Id: 318634
View PSSM: pfam16472
Aligned: 38 rows
Threshold Bit Score: 188.963
Threshold Setting Gi: 524607923
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3S25_A        10 NTAGNLYNAGLFC-ESDGEVFFSNTNDNGRLYAXNIDGSNIHKLSNDTAXYINADKNYVYYVRNNNQKITSQTFF--SYD 86
gi 524814690  41 NTGGNLNNHGLFA-EADGRVYFSNAYDGGCLYSMNPDETDLKKLTSSSVNSINVGGNYLYYYLDNATGGKGLGYV--IH- 116
gi 524345638  40 NTAGNLNNSGYFC-EYDGTVYFANAYDSNTLYSMDPSEQNIKKLGNASVKNILAGGKYLYYYQTGASGDAGIGAL--RTV 116
gi 524631678  41 NTAGNLNNGGLFA-ESEGRVYFSNAYDGGCLYSMNSDETDLKKLGSSSVNSINVGGRFLYYYLDSAAGGTGLGYV--VR- 116
gi 524471745  42 NSAGNLYNGGLFC-ESNGTVFFSNPSDNHRLYSMNPDGSDMKKLSDDTVSYINADDHYVYYVRNNKSEDTNFSFL--NFG 118
gi 503046146  38 NSAGNLHNGGLFF-EMDGKVYFSNPYDSDCLYSMNPDETNPKRLTSMRVKYISGANGFLYFYMDSTKKSGSVGGLgtVTN 116
gi 291538544  40 NTAGNLYNAGIFCtAADGTIYFANPSDNSKLYSMNSDGSDLTKISDDVATFINADDNYIYYVRNNPVFTEPFSFL--TIN 117
gi 524310051  41 NSAGNLYNGGMFC-EYNGKVYFANPYDGNALYVMDTDGSHMKKLIATSVSNICAGGKYLFYFQNTSSGTAGLGYL---FS 116
gi 291519549  40 NTIGNLYGNGLFC-ESDGVVYFANPNDYSRIYKMNPDETDIEILANDSVYFINADSHYLYYSRNHNRDNSQMGFL--NVN 116
gi 524157025  41 NTAGNLNNGGYFC-EADNKVYFANAYDDYTLYSMNPDQTEITKLGQSSLAFLNKGGNYLYYYQKEASKASGLGFL--IHM 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3S25_A        87 RNSLCRIKRNGHGSTVLDPDP-CIYASLIGNYIYYLH-YDTQTATSLYRIRIDGEEKKKIKN-HYLFTCNTSDRYFYYNN 163
gi 524814690 117 TYGVYRSKSDGSNSKCLDRQA-AVTMQLAGDYIYYQR-YNNTDFTKFYKIKTDKSGQKLVSD-EIISPNACHNGIIYYNG 193
gi 524345638 117 R-SFNRCKLNGTDVTGLTRDP-IVSAQLVGSNLYIMT--SGDNGPLFYRMKIDKSDKTDLAD-YEINPACAVNGTIYYNG 191
gi 524631678 117 TYGVYRSTLEGKDVTCLDRNA-AVTMQLSGDYLYYQR-YNNTDFTQFYKIKTDKTDNVLVSD-EIINPASCANGIIYFNG 193
gi 524471745 119 TNSLCRINRDGGRVTILDDDP-SLYAGLYGNYIYYIH-YDKETASTLYRIKIDGTKKEQVSK-FPYKTCSSNGQYMYFNG 195
gi 503046146 117 QYGIYRCKINGTDQTCLLRDF-CGEMQLCGEYLYYVT---KLEGGALHKIRVDKKNKSLVAP-EPISPVCYDRGIIYYTG 191
gi 291538544 118 TDSLCRLDRSKHKKSILLDSSaSLYASLVGNKVYYLH-YDDKDFTTFYEVGIDGADSHQVDK-TPYRPCSVVGQYIYFNG 195
gi 524310051 117 SHSLCRAQLNGRHITSLSKEV-IYNMQLIDNYLYYQ--CAGTDGPRFYRQKISAREPELLERiSADFSCALPDGTVYYAG 193
gi 291519549 117 LNSLCRMKKKNLKVDILDDEN-CNACALAGNTVIYLR-YDAEDASSMYSVKIDGTEKQQLSK-VPIDPRCVVGEKLYFAG 193
gi 524157025 118 -SGIYRCKTNGKNITCLDHSS-CNTLNLIGNTLYYEKaVDNAKTLQLYAINTDKSDARAVAE-YLVNPASAASGVIYYNG 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3S25_A       164 P-KNGQLYRYDTA-SQSEALFYDCNCYKPVVLDDTNvYYXDVNRDNAIVHVNINNPNP-VVLTEANIEHYNVYGSLIFYQ 240
gi 524814690 194 TdKDHNLYALDTR-SDSTSLLLEGNICYPVYAYDYI-YYMDASSNYRLCRYSLSTGAV-EVLTEDRVDTYNVGNGYVYYQ 270
gi 524345638 192 TqENHYLYALNTS-TDSISTLWDGNLWYPIVQGDYI-YYMDVENNYRLCRYSLSRNEV-EVLTEERIDCFNVGYGYVYYQ 268
gi 524631678 194 TsKDHNLYTLDTR-TDTISTVLQGNLWFPAYQDGYV-YYLDLSENYRLCRYSFSENTV-QVLTSDRVDTFNVGYNCIYYQ 270
gi 524471745 196 EnDSHSLLQLDTA-DNSVATLYSCTCYEPTVINDTA-YYMDGDNDYGLSTYSLSSGAA-NLIIPSRIDCYNVTGDYIYYQ 272
gi 503046146 192 VsSDHYIHAMNTQaGDAISDVLPGHLFFPVVQGNYL-YYMNGDSNYSLWRTNLMNGET-EVITSERLDFYTLDDQHVYYA 269
gi 291538544 196 VsNDHNIWRFDTV-TDTSELVLKGNYYMPAVIGDTI-FFLDNENNYTLASTDLSGSSAiTTLSDDRIDCYNITGNYIYFQ 273
gi 524310051 194 NnTNHYLYRYDTH-SGSTSAAWQGDLWYPVYDNGYI-YYLDVANNYRLCRYSLSADEI-EVLTNDRVDCFNLTGNYVYYQ 270
gi 291519549 194 VeQDHNLHSMNIY-TKDITYVSSNNLWLPIIDGKVL-YFMDLDNHKRIYKTTVGSTEK-VAVTTYPAQNYNVSGTYLYYQ 270
gi 524157025 195 TtEDHYLYSYDTQ-SGTVQTLFEYNMWYPTLSGSSI-YYLDTENNYQLCRYDLTDGSN-TVLTTDRVDLFNIAGSYVYYQ 271
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
3S25_A       241 RGGDNPA-LCVVKNDGTGFKELAKGEFCNINVTSQYVYFTDFVS-NKEYCTS 290
gi 524814690 271 KNDADAPaLMRMEADGSNPEVVALGIYSDINLTSQYAYFHEFNSdVPMKRTP 322
gi 524345638 269 VNGGE-AcLKCMRDDGSDSWVIAEGNYTAIHMTSQYVYFQMFGEtSTWYHSP 319
gi 524631678 271 RNSATDPaLICMNLDGSNPVVVAQGNYENINLTSSYAYFNAFGEeTPVYHSP 322
gi 524471745 273 KN-GEGAgIYRCLTDGSNEELLISGNYTALHTTSQYLYFYEYGNdSACYQMP 323
gi 503046146 270 YAGGENSaLKMCDLDGYGKTVLFEGVTNSLNVTSQYLYFKVYGQdEVVYHMP 321
gi 291538544 274 RNSTSTPaLCRMKTDGSDYTVIAEGNYTNINATETDVYFRDFAS-GVMYKTP 324
gi 524310051 271 KNSVENPaLIRMQKDGSNPVILMDGNYTHISVAGDYVYFAAFENgYPLYRVa 322
gi 291519549 271 SMKGNPDgLYRVDLLSGAEVLLAEGQYNNINITSKYVYFADFYSgSTFHCpi 322
gi 524157025 272 KNDPSSPaLMRMGIDGNNPEIVAEGNYSDINVTSSYVYFHSFGAdTPVYQTS 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap