4OO3


Conserved Protein Domain Family
Oxidoreduct_C

?
pfam16490: Oxidoreduct_C 
Click on image for an interactive view with Cn3D
Putative oxidoreductase C terminal domain
This is the putative C-terminal domain of a bacterial oxidoreductase. It lies C-terminal to family GFO_IDH_MocA pfam01408 in some members.
Statistics
?
PSSM-Id: 318650
View PSSM: pfam16490
Aligned: 22 rows
Threshold Bit Score: 479.513
Threshold Setting Gi: 311302631
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OO3_A       159 LQRELSTIPAVYGEQLKGSPEEPAIVKESVHHLFKLVDNKPLTRPVWYLDVNQQGEGIVDVTTHLVDLVQWEAFPDQIID 238
gi 503529866 184 LQRELAQMPALFGTLEKGTPDNPAITKESVHHFFKYVSGSALIRPAWFFDVEQQGEGVVDVSTHLVDLVLWECFPEQSIS 263
gi 502418234 176 LQRELAAIPEIFGSLQKGSPQQPAVEMESIHYFYKYVSGKILTRPSWFMDTSQQGEGIADVAVHLVDLVQWACFPDQVIR 255
gi 575458647 186 LQRELANRAAVFGTLVKGTPENPGIRMESIHYLYKNVNGTPLRRPEWFFDVKQEGEGLQDVGTHLIDLVQWEAFPDQPLR 265
gi 503398579 175 LQAQLSQDLGILGRLSEGSLEKPSIEMESVHYFSKVVSGKPLIRPYWFMDVAQQGEGIADVAVHLVDLAQWGYFPNQVLD 254
gi 503984192 177 LLRELSMEPEIFGALEKGTLADPAVVKTSIHYFYKFVSGNVLTRPEWFFDASQQGEGITDVMTHLVDLVQWECFPEQTID 256
gi 311302631 201 LQRELSMIPEVFGTIEKGTLENPAITKESVHHFFKYVSGAPLIRPEWFFDTEIEGSGLVDVTTHLVDLVQWEVFPEKALD 280
gi 504843854 172 LQKEISQIPQIFGTLQNGTPENPSIIKESVHHFYKYVSGSPLKRPTWFMDVSQQGEGIVDVTTHLVDLVQWAAFPNVVLS 251
gi 503071509 181 MQKLFSQSSSVFGKLVDGTLEEPAISKVSVHHFFKYVSGQPLVRPPWFFDVNEEGEGIVDVTTHLVDLVQWEAFPEQIID 260
gi 495861076 181 LQRELAQMQKVFGTQEKGTPDNPGVTKSSVHFLYKSVSGAVLQRPAWFFDVTQQGEGIADVSTHLVDLAQIECFPGQALD 260
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OO3_A       239 YRKDIELIDANRWTTSISPEEFKQVTGTDAYPDFLKKD-V-ENDTLKVYCNGDIVYKIKGVTAKVSVIWNYTFPKGGGDT 316
gi 503529866 264 YQKDIQLQAAKRGATDLTSAQFKLVTGLPGFPSFLKKD-LsKDSTLQVFANGETHFSVKGVHAKVSVIWNFQAPEGAGDT 342
gi 502418234 256 YEKDIQLNSASRWPTAITLSQFNAITKSNGFPDYLKKD-V-KDTLLNVFANGEINYKLRDVYVKVRALWDYKAKAG-GDS 332
gi 575458647 266 -ESDVTVLSSRRWATPVTPAQYKTVTGADSFPSYLKGD-V-RNGALQYFSNGDVVYRIRGVNVRVQATWDFEAPKGSGDQ 342
gi 503398579 255 YRKDIELLQAKRWPTSMTLPQFTKITNLTAFPESLNPY-L-KNNVLEVFANGEIDYKLKGIHVKIKALWDYEATKG-GDT 331
gi 503984192 257 YAKDIQLDAAKHWTTDLSLNQFKTVTKAAAFPAFLKSSaA-NDTLLKIFYNGEINYTIKGVHARTTALWDYQAPAG-GDN 334
gi 311302631 281 -TADVEMLEAELLPTSLNYEQYELVTRKK--PPFENGE------TLDVMANGEMNYTLKGVHAKVSVKWAYQAPEGTADT 351
gi 504843854 252 -TKDVQLTSAKRWPTTMTLNQFSVITSQNHFPDFLKKDlK-NDTTLNIYANGEINYKLRGVNTKVRVLWNYSTPEG-GDT 328
gi 503071509 261 -TANIEMLWAKRWPTILTKKEFSKVTSLDSYPQYLEKD-I-NQDALHVYSNGEMNYRINGKHAKVSVVWNYQAPEGTGDT 337
gi 495861076 261 YQKDVELVSAKHWTTPLTLSQFTEITKQPAFPDYLKQNvT-KDTILNTYFNGSFQYKLRGINIKITATWDYKAPAGSGDT 339
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4OO3_A       317 HFSVXKGSKADLVIRQGKEQNYQPELFVEAVKGVdlA--AYEKDLTASXEKVSA-EYPGVALNKVGDGvWQVEIPAKYRV 393
gi 503529866 343 HFSIMRGTKANLVIRQGAAEKYRPVLYVEPLPNVdkA--SAETALKDALQKLNAgQFQGLGYEASEKG-WKILIPDSYNV 419
gi 502418234 333 HYAVFRGTKADLVIRQGADQDFKPSLYILPSVSPa-NlfAYEQALNDKINVVKA-RYPGIELKKIDKG-WEVLIPEQYKN 409
gi 575458647 343 HHSVLRGTKATLEIRQGAPEKWKPTLYVRRDASVpaA--DFERALRAAVASLQA-TYPGVEVQPSGDE-WQLVVPTKYDI 418
gi 503398579 332 HFAIIRGSKSNIVIRQGTEQNFEPTLYVEPLNAAdrA--SVKAALDNKIAEVQK-EYPEIQLKETKLG-WEVYIPKAYRE 407
gi 503984192 335 YYALMKGTKARLVIKQGAAEKYKPVLYLEPV--------DKKLDPTEAFKKIQA-KYPGVELMKTATG-WQV-VTSTYTE 403
gi 311302631 352 HYSIMRGSKANLIIRQGANESYKPVLYVKLLE-------DQAEALEKAVLTDLQgKYPGIGLTKLETGeYKIEVPSSYSV 424
gi 504843854 329 HYSIMKGSKANIEIRQGKAEKFIPQLYIQTDKVSd-A------DLLKAFDALQK-KYPGISLIKQEKe-WLVEIPDNYRT 399
gi 503071509 338 HYSIMRGTKCNLIIRQGKEEKFKPTLYIEVFDGN-----GFENVLQDVLLGKVReLFPGTTSDKISNTmWKINIPEEFKI 412
gi 495861076 340 YYSALRGTRANLTIRQGLEENYKPTLYIEPVKSNd-A--SFEKDLTDAMATLQA-KYPGVSIKKTAKG-WQAVVPEKYNT 414
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
4OO3_A       394 GHEAHFGQVTEHFLDYLKEGKLPDWEVPNXLAKYYTTTSALDXAK 438
gi 503529866 420 GHEAHFAQVTEKYLQYLAQGKLPEWEVPNMLAKYYVTTKAYAMSR 464
gi 502418234 410 GHEAHFAQVTTRFLAYLKNGNMPAWEVPNMLAKYYTTTQALSLAi 454
gi 575458647 419 GHEQHFAQVTNDYLSYLRAGKLPAWEVPNMLVKYATLAKAYELSH 463
gi 503398579 408 GHEAHFAQVTKKYLSYLEKKNMPEWEVPNMIAKYYTTTQALKMAT 452
gi 503984192 404 GHEEHFARVTQNFLQYLKNKNMPAWEVPNMLAKYFITTSALQLAE 448
gi 311302631 425 GHEAHFAQVTENYLKYFKAGELPDWEVPNMIVKYYTTTQAFAAAq 469
gi 504843854 400 GHEAHFGEVMERFLDYKAKNQLPAWEVPNMLVKYYTTTKALELAK 444
gi 503071509 413 GHEEHFAQVTQNYLNYLEKRQLPVWEEPNMISKYYTTIAAYKMAK 457
gi 495861076 415 GHEAHFGQVMQHYLQFLKEKKLPAWEVPNMITKYFTTTAALELAK 459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap