3QUX


Conserved Protein Domain Family
MHC_I_3

?
pfam16497: MHC_I_3 
Click on image for an interactive view with Cn3D
MHC-I family domain
Statistics
?
PSSM-Id: 318657
View PSSM: pfam16497
Aligned: 19 rows
Threshold Bit Score: 299.636
Threshold Setting Gi: 940780025
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3QUX_A         1 SEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRD 80
gi 12229604   19 FEAPQTSFPFRFLQISSFANHSWTRTDGLMWLGELQPYTWRNESSTIRFLKHWSQGTFSDQQWEQLQHTFQVYRSSFTRD 98
gi 545822502  19 EEGFQEPISFQIIWISSFYNRSWEEEVCSAWLGELQTHRREGKSDIVIYRQPWSKGNFSREDLMESEHILRMFFVRFVQA 98
gi 347015027  19 SEVPQRNFPFRCLQISSFLNRSWARTDALAWLGELQPYVWKNDSDTIRFLKPWSQGTFSDQQCEELQHLFRVYRSSVTRD 98
gi 625287232  19 WEDQLKNYPLRCLQISSFPNSSSFRTDGLAWLGDVQTHSWRNAS-TVSFLKPWSHGKLSDQQWQTLEHILQVYRTSFTRD 97
gi 914929312   7 glwlpnrVLFRCLQISSFTNSSWMRTDALAWLGELQTHSWSNASDTISFVKPWAQGTFSSQQWIHLQNTFRVFRSSFIRD 86
gi 795472681  19 AEVPQRLFPLRCLQISSFANSNWTRTDGLAWLGELQTHSWSNDSDTIRSLKPWSQGTFSDQQWEALQRVFRVYRSSFTRD 98
gi 664752286  19 KDDFQEPISFQIIQISSFYNRSWVQNLSSGWLGELQTHSCESKSGTIIFLWPWSKGNFSNEEIMELEKLFHMFSAGFLQA 98
gi 356582540  19 KDDFQEPVSFQIIQISSFYNRSWVQNLGSGWLDELQTHGWESSSGTIIFLWPWSKGNYSNEEWMELEKLFRMSSIGIPQM 98
gi 545216311  53 KDDFQEPTSFRVIYSSSFYNPSRVQALGSAWLGELQTHGWENHTGSFIFLRPWSKGNFSSEELTEIEKLFRTFSIEFNQI 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3QUX_A        81 IQELVKMMspKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATV 160
gi 12229604   99 IREFVKML--PGDYPFEIQISGGCELLPRNISESFLRAALQEKDVLSFQGMSWVSAPDAPPWSQVVCKVLNEDQGTKETV 176
gi 545822502  99 FFNHASQW--KLEYPFDVQIAGGCDLYHGETSVGFVRIAYQGSDFASFQKNSWLPSPKGGTRAQLVCKLFNLYQGTLEII 176
gi 347015027  99 IQEFAKML--HIAYPLEVQVSAGCEVHPGNTSESFLYAAFQGRDILSFQGTSWVPAPDTPQWVARVIEVLNDDQGTREMV 176
gi 625287232  98 IQELVKMLp-IIHYPIEMQVSAGCEVHSGNTSENFFNVASQGQHILSFQGTSFQKAPDAPPWTELAIKVLNTDQGTRETI 176
gi 914929312  87 IQEFAKML--SLEYPTELQLSGGCEVHPGNDSEHFLHVAHQGEHILSFQGTAWEPAPQAPQWVDLVIKVLNQNQGTKETV 164
gi 795472681  99 VKEFAKML--RLAYPMELQVSAGCEVHPGNASHNFFHVAFQGSDILSFQGTSWEPAQEAPLWVNLAIQVLNQDKWTKETV 176
gi 664752286  99 FHEHASQW--QLEYPFQVQTAGGCELHFGKASISFMRVAYQGSDFLSFQNNSWLPSPKGGNRAQHVCQLFNWDQITLEII 176
gi 356582540  99 FHNLASQW--QLEYPFEVQITAGCELHFGEISVGFMRGAYQGSDFMSFQNNSWLPSPDGGSRAQHACELYNGDKVGLEIT 176
gi 545216311 133 FHNHASQW--QLAYPFQVQLAMGCELHIGEASVGFARIAYQGSDLISIQNNSWLPSPKGGSRAQQVSGRFNLNKVFLETW 210
                        170       180
                 ....*....|....*....|..
3QUX_A       161 QMLLNDTCPLFVRGLLEAGKSD 182
gi 12229604  177 HWLLHDICPELVKGLMQTGKSE 198
gi 545822502 177 HKLLSDTCPRFVLGLLDAGKAD 198
gi 347015027 177 QSLLNDTCPQFVRGLLETGKSE 198
gi 625287232 177 QQLLNDTCPQVLYGLLEAGKAE 198
gi 914929312 165 QWLLNDICPQFVNGLLETGKSE 186
gi 795472681 177 QWLLNDTCPQFVSGLLESGKSE 198
gi 664752286 177 QRLLSDTCPRFLLGLLDAGKSD 198
gi 356582540 177 DRFLSDTCPRLLLSLLDAGKAD 198
gi 545216311 211 HRLLTDTCPRFLLGLLDAGKAD 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap