Conserved Protein Domain Family
DiSB-ORF2_chro

?
pfam16506: DiSB-ORF2_chro 
Putative virion glycoprotein of insect viruses
DiSB-ORF2_chro corresponds to a short conserved region at the N-terminus of putative glycoproteins from chroparaviruses. It carries two putative disulfide bridges. No similarity can be found with any other glycoproteins outside this region.
Statistics
?
PSSM-Id: 318663
View PSSM: pfam16506
Aligned: 6 rows
Threshold Bit Score: 91.4928
Threshold Setting Gi: 384638751
Created: 31-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 831181915  53 SPYMFDRSCLNVYRTNDYLFGECTLPPNCSEPSVVKLDKTFYGQETVVCHS 103
gi 384638721  91 SPYMFDRSCLNVYRTNDYLFGECTLPPNCSEPSVVKLDKTFYGQETVVCHS 141
gi 384638751  53 SPFEFDPECIEVHRTHSWFFQGCTLPPSCGDVHTKILDSSF-GFKELMCYS 102
gi 384638746  53 SPFEFDPECIEVHRTHSWFFQGCTLPPSCGDVHTKILDSSF-GFKELMCYS 102
gi 723604078  50 SPYHTDPTCVSVYRTNDWFFAGCELPPHCLGKVVSIIEKKWYGQETVFCHS 100
gi 384638736  53 SPYMFDRSCLNVYRTNDYLFGECTLPPNCSEPSVIKLDKTFYGQETVVCHS 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap