4OH8


Conserved Protein Domain Family
Nore1-SARAH

?
pfam16517: Nore1-SARAH 
Click on image for an interactive view with Cn3D
Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
The Nore1-SARAH, C-terminal, domain of Nore1, the tumor-suppressor, a novel Ras effector, has a characteristic coiled-coil structure. It is a small helical module that is important in signal-transduction networks. The recombinant SARAH domain of Nore1 crystallizes as an anti-parallel homodimer with representative characteristics of coiled coils. The central function of the SARAH domain seems to be the mediation of homo- and hetero-oligomerization between SARAH domain-containing proteins. Nore1 forms homo- and hetero complexes through its C-terminal SARAH (Sav/Rassf/Hpo) domain.
Statistics
?
PSSM-Id: 318672
View PSSM: pfam16517
Aligned: 68 rows
Threshold Bit Score: 29.0271
Threshold Setting Gi: 994310093
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|
4OH8_B         8 AFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEAL 47
gi 432106035 328 KFEMPVLDSFIEKLKEEEQREIIKLTMKFQALRLTMLQRL 367
gi 50345048  269 KFELPVLQSFIAKLQEEEEREMQKLKTRYAEMQRIIKRCM 308
gi 241849268 326 nFSEVELLSFIQKFHEEEAREVEKIKSRYAIMRQRILARM 365
gi 597782980 272 KLEMPVLQSFINKLKEEELREMNKLKQRYSDMRSVIKKHM 311
gi 761912986 217 rFQLPELNIFLKKFDEEEQREKEKLRRR------------ 244
gi 597771640 269 KFEMPVLDSFVKKLREEEEREIYKLTTKYSALKSMILQQL 308
gi 994310093 268 KFEMPVLDSFIKKLKEEEEREILKLTRKYRMLKSVILQKL 307
gi 410901294 258 KFEIPVLDSFVQKLKEEEEREIRKLTRKYSAIKAMIQHQL 297
gi 941813505 276 KFEIPVLDSFVEKLKEEEEREIVKLTKKYSSLRSMILHQL 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap