3E7K


Conserved Protein Domain Family
TRPM_tetra

?
pfam16519: TRPM_tetra 
Click on image for an interactive view with Cn3D
Tetramerisation domain of TRPM
TRPM7_tetra is a short anti-parallel coiled-coil tetramerisation domain of the transient receptor potential cation channel subfamily M member proteins 1-8. It is held together by extensive core packing and interstrand polar interactions. Transient receptor potential (TRP) channels comprise a large family of tetrameric cation-selective ion channels that respond to diverse forms of sensory input. The presence of cytoplasmic domains that direct channel assembly appears to be a feature of many voltage-gated ion channel superfamily members.
Statistics
?
PSSM-Id: 318673
View PSSM: pfam16519
Aligned: 18 rows
Threshold Bit Score: 75.7915
Threshold Setting Gi: 206582076
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|..
3E7K_A          5 RVTFERVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTL 56
gi 655600569 1238 RVTSERVENMSMRLEEVNEREHSMKASLQTVDIRLAQLEDLIGRMATALERL 1289
gi 260814638  619 RMTQDRVEHMSMRVDEVHEKEGAVKVSLTSLDQRLARLENVSAVTTTTLQRL 670
gi 884932299 1176 RVTCERVENMSMRLEEINERENFMKTSLQTVDLRLSQLEELSGRMVNALENL 1227
gi 410908253 1230 KVTSERVENMFMRLEEVNERENTMKASLQTVDLRLAQLEEIHGRMAVALEKL 1281
gi 752865197 1200 KVTTDRVENMYQKIEDIDKKESTQNASLQTVEFRIRKLEELSQQTVAHLGVi 1251
gi 827562612 1197 RNTTDRVEHITTKMEDLNQKANCQIQSMQSVEFRLRKLEDIAEQTMSHLAVi 1248
gi 242004784 1100 KTTTEKVENMYQKVEDINQKENAQTTSIQSVEFRLRKVEDVAEQILNHLDvv 1151
gi 328713852 1176 KMSLEKTENIQQKVDDINQKENLQNSSVQALEFRLHKIEDLMDQTLSTLGVi 1227
gi 847092302 1191 RVTTERTEEMFAQLKEVNDKVFYIKDSLSSLDSQLGHLQDLSALTVDTLKII 1242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap