Conserved Protein Domain Family
betaPIX_CC

?
pfam16523: betaPIX_CC 
betaPIX coiled coil
betaPIX_CC is the very C-terminal coiled-coil region of betaPIX or p21-activated kinase interacting exchange factor proteins. The coiled-coil runs from residues 589-646 in UniProtKB:G31IU6, and the PDZ-binding site is the final eight residues immediately downstream. The coiled-coil trimerizes and thus exposes three potential PZD-binding surfaces, although only one of these is maximally used. One of the C-terminal ends of the coiled-coil forms an extensive beta-sheet interaction with the Shank PDZ, while the other two ends are not involved in ligand binding and form random coils. Thus the coiled-coil domain allows multimerisation of betaPIX that is vital for its physiological functions. betaPIX and the Shank/ProSAP protein form a complex that acts as a protein scaffold for integrating signalling pathways and regulating postsynaptic structure.** Forced reload
Statistics
?
PSSM-Id: 318676
View PSSM: pfam16523
Aligned: 19 rows
Threshold Bit Score: 108.982
Threshold Setting Gi: 541044203
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74965346   729 ESYQQPHLIVAEDEKILMEEMIGD-EVVLQEKSIVDAVYAIKDQLSFLQTEFQKLAKVVESEQKARRRLEHNLPKMSGVI 807
gi 260797570  482 RLEQAPQVLVPEEEKIIVEETKNN-QTVVQEKSLVDTVYQLKDQVEELCKETKRLNKGLEEEVMARKRMESIIRKSIKSL 560
gi 308486933  547 ENYQQPHLIVAEDEKILMEEMVGD-EMVLQEKSIVDAVYSLKDHVMVLQADLKSLQKAFETEQKARRRLEHMLPKMSGII 625
gi 341894435  547 DSYQQPHLIVAEDERILMEEVVGD-QVVFQEKSIVDAVYIIKDQLAEMQTELQKLTKAFEQEQKARRRLEFNLPKLSGLI 625
gi 402594786  151 HEYDAPQLIVAENEKMFMEEMIGD-QVVVKEKSLVDTVYALRDQLSNVQKELLQLNKTVDREQKSRRRLEEMVRRLCqql 229
gi 762132149  674 sfvTSPHVLMPEEEKIIMDD--GD-PSNLQEKTLVDTVYSLKDQVRMLEKEHKKMKHDLEEEKKARRQLETSIKKSMKS- 749
gi 597784252  713 RRDTAPALIVPTEEKMTVEGLKSNgQTVIGEKSLVDVVYALREEVQELKQDNKKMKHSLEEEQRARKDLERIVRKVLKNL 792
gi 1040698333 693 WKDGSPALIVPGDEKFSVDELKSNgQTLLEEKSLVDVVYALRDEVQELKQDYKKMKKSLEEEQRARKDLERIVKKMLKNM 772
gi 1040654299 554 RKESGPHMLFPEEEKIIVEETKSNgQTVIEERSLVDTVYALRDEVQELKQDNKRMKRTLEEEQKARKELEKVVRRVLKSM 633
gi 700362165   32 RKESAPQVLLPEEEKIIVEETKSNgQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNM 111

                  ....*..
gi 74965346   808 SPDGSSS 814
gi 260797570  561 AETNFDE 567
gi 308486933  626 SPDGSAS 632
gi 341894435  626 SPDGSTS 632
gi 402594786  230 qqqqhqq 236
gi 762132149  750 NNLIWEE 756
gi 597784252  793 NDPTWDE 799
gi 1040698333 773 NDPSWDE 779
gi 1040654299 634 NDPSWDE 640
gi 700362165  112 NDPSWDE 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap