3V67


Conserved Protein Domain Family
CpxA_peri

?
pfam16527: CpxA_peri 
Click on image for an interactive view with Cn3D
Two-component sensor protein CpxA, periplasmic domain
CpxA_peri is the periplasmic domain-family of the Gram-negative Gammaproteobacteria two-component signalling system, Cpx. It represents the recognition-site for sensing specific envelope stress signals. The fold that the domain-core of CpxA_peri conforms to is a PAS fold. The domain senses the environmental change and triggers a signal transduction to the cytoplasmic domain. As well as the PAS-core, there is a C-terminal tail that is necessary for ligand-sensing and binding to CpxP, a CpxA-associated and a regulatory protein.
Statistics
?
PSSM-Id: 318680
View PSSM: pfam16527
Aligned: 10 rows
Threshold Bit Score: 197.96
Threshold Setting Gi: 81615681
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3V67_B         6 PRKARDIPDEHYQRIIETRDAIQNKYS-KETDLGRILFRVEG--NRA-----GKH---DPRPRVFFSDYNGNVLTTDKRS 74
gi 81544330   38 PRKSRDLSPETHQRLLESRDRFEQQFR-NQSDLRAILFQLEGpdSQH-----RKH---DGQPRFFITDLESNIITNSKQT 108
gi 75353300   41 PRSRHNIAAEHLTKMTQIAAYITGKYS-ERDNLKKTLKEISHraHRH-----------DENLDLFFTTPTGEILDKPREL 108
gi 81615681   36 PRAQHTIPAQNLKRLQDSAQDISERISdERGSLKQKLKRYTDrdNH-------------KGIQLYFTTEDGEIISP---- 98
gi 81756418   36 PRKARNIPADQYDRFIEAKQEIEKQYR-GETDLGRILFRMERpgDR------HGR---DGRPRFFITDYDGNILTTLKQG 105
gi 503427632  36 PRKQTEVPPERLEQLLTFRDQIESRFS-HFNRIEEIVPILTEpkRFKkiddkNKDkhgDGRQRFFLTDYEGRLLGTERR- 113
gi 501016590  36 PRKPRDIPPPHYDRMLQIRDQVERNFA-SAPDLAKVLHDLDGwsRR------GPD---DNKLRLFITDLDGNVITTDRRP 105
gi 515663934  36 PRVARDVPADHLDKLERIAKFTEKRYA-KESNLGKIVFQLEAprSRK-----------DSRARIYLTDLEGAVLTSKRHS 103
gi 490866492  36 PRKTRDIPPEGYQRLLEYRNAIENRFG-REENLARILMRLEE--NGG-----HKN---EERSRFFLTDLDGNILTTKKHA 104
gi 503621760  36 PRKTRDIPSDEYQRLTHLKQKIESMFK-DEHELTRILFRLESssNKRgeghmREK---NGTPQFFITTPDGTILTTKTQA 111
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
3V67_B        75 NFQLRAMQNFVTSIEDYNKPKQRLYGRYMIAGPVPIVLADSELLMYVGFKWNEPP-PLLLRLFD 137
gi 81544330  109 DFRFKAMQNFCSSIESVQKPQQRLYGRYMLAGPVPITLAKQDLLLYVGMRWDEPP-PFLLRLFD 171
gi 75353300  109 RGRKKALLNFLTLSDNPELPQQKLYGRTMMAGPFDIVIAHETVYMYVGRYWKKPP-PFILRILD 171
gi 81615681   99 HGRNKALRNFITIADDPQNPRQKLYGRWMMAGPLKVTDQQQTTLMYIGRIWRETP-PFFIQILD 161
gi 81756418  106 DFQLKALKNFVTSIEQPDQPKQKLYGRFMLSGPLPVTLANKEYLLYVGMRWNQPP-PFLLRMFD 168
gi 503427632 114 DLSYKAIRNFISSIERSDKPMMRLYGRFMLSGPVPIKLADDNYFLYVGMKWNEPPlGFLIGLLD 177
gi 501016590 106 DFSYKALRNFVTSIDNPQDPQQKLYGKTMISGPLPIRLAKKDYFLYVGTRWSEPP-HFLLQLFD 168
gi 515663934 104 NYKLKAIRNFVTSIDNPELPKQKLYGHYMVAGPVPITLAGEELLMYAGVKWNQPP-PFLLRLFD 166
gi 490866492 105 DFKLKALQNFTTSIESIEKPQQRLYGRYMIAGPLPIQLAQRDLLLYVGLRWDEPP-PFLLRLFD 167
gi 503621760 112 DFKFKALQNFVTSIESIDKPQQKLYGRYMISGPLPITLAKQDLLMFVGIRWNEPP-PFLLQLFD 174
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap