3TY5


Conserved Protein Domain Family
PNKP-ligase_C

?
pfam16536: PNKP-ligase_C 
Click on image for an interactive view with Cn3D
PNKP adenylyltransferase domain, C-terminal region
This is a short unique anti-parallel two-helical module with an extended tail peptide. It packs tightly against an extended peptide segment, residues 489-501 in UniProtKB:A3DJ38, near the N-terminus of the NTase domain, pfam16542. PNKP (polynucleotide 5'-kinase/3'-phosphatase) is the end-healing and end-sealing component of an RNA-repair system present in diverse bacteria from ten different phyla. RNA breakage by site-specific 'ribotoxins' is an ancient mechanism by which microbes respond to cellular stress and distinguish self from non-self. Ribotoxins are trans-esterifying endonucleases that generate 5'-OH and 2',3' cyclic phosphate termini. Repair of this type of RNA damage is feasible via sequential enzymatic end-healing and end-sealing steps. The exact function of this C-terminal region is unclear; however, the conformation of the bundles changes on transfer of a PO4 from ATP to AMP.
Statistics
?
PSSM-Id: 318687
View PSSM: pfam16536
Aligned: 32 rows
Threshold Bit Score: 77.6606
Threshold Setting Gi: 328807984
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
3TY5_B       354 ENIERLRNRAVGKKRSLALREFSLGMEALERFVRNEPLYRVHECVFGVLALESEPVDPRL 413
gi 504717128 809 ENLVRLKQRNVKRKQRHALMEFALGVEGVKRFVSQEPISRIHECVLATLALEAEPVDPRL 868
gi 503323741 782 EHLARLRERHLGAKRARALREFALGVEGLTRFVGREPLWRVHQCVLGVLAFETDPVDPRL 841
gi 503134917 810 ENLKRLKQRRTNKKERHALMEGALGMEGVERFVRKDTVERIHECVLAALSLESEPIDPRL 869
gi 500313817 793 EHIARLRQRKLEGKRALALREFALGHEALTRFVAREPLRRVHECVFAVLALESEPIDPRL 852
gi 763122400 829 gNLERLRERNVKSKRNLALREFTLGVEGLERFVAGAPLREVHQCVFGVLALESEAVDPRL 888
gi 504499627 788 EHLERLRSRGLNAKRSLALREFALGIEGLERFVRGEPLRRVHECVVGVSALESEGLDPRL 847
gi 504998374 857 ENLERLRQRGLSRKRSLALREFALGIEALERFVAKEPLRRVHECVFGILALESEPIDPRL 916
gi 502450151 788 ANLNRLKKRGLGAKRGLALREFALGVQAIEHFVAKEPLRKVHQCVFGLLALESEPVDPRL 847
gi 524639981 796 AHLERLKKRSLSRKRSLALREFALGMESLNRFVAKEPLHQVHACVFGVLALESEPVDPRL 855
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap