4Q2J


Conserved Protein Domain Family
CUTL

?
pfam16557: CUTL 
Click on image for an interactive view with Cn3D
CUT1-like DNA-binding domain of SATB
CUTL is part of the N-terminal region of SATB proteins, special AT-rich sequence-binding proteins that are global chromatin organizers and gene expression regulators essential for T-cell development and breast cancer tumor growth and metastasis. CUTL carries a DNA-binding region just as CUT domains do.
Statistics
?
PSSM-Id: 318706
View PSSM: pfam16557
Aligned: 3 rows
Threshold Bit Score: 138.232
Threshold Setting Gi: 405975691
Created: 7-Apr-2017
Updated: 23-May-2017
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
4Q2J_A       113 LPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKT 180
gi 405975691  22 ISPEKWTDQTVRCAVLALLKEMSQSTLAKLCPLTQSAISNIANWKYTSKVSADKCKEFGVWYKQYHSM 89
gi 542248590 179 LPSDQWTHATVRNALKELLRETNQSALAKECPLSQSMISAIVNSSYYANVSTSKCQEFGRWYKRYKRI 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap